KEGG   Pseudomonas koreensis: AYO71_25240Help
Entry
AYO71_25240       CDS       T04647                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pkr  Pseudomonas koreensis
Pathway
pkr00473  D-Alanine metabolism
pkr00550  Peptidoglycan biosynthesis
pkr01100  Metabolic pathways
pkr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pkr00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AYO71_25240
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AYO71_25240
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    AYO71_25240
Enzymes [BR:pkr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AYO71_25240
Peptidoglycan biosynthesis and degradation proteins [BR:pkr01011]
 Precursor biosynthesis
  Amino acid ligase
   AYO71_25240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 ATPgrasp_Ter RimK ATP-grasp_5 GARS_A ATPgrasp_YheCD TTL FOG_N
Motif
Other DBs
NCBI-ProteinID: AMT90701
UniProt: A0A142NIQ7
LinkDB All DBs
Position
complement(5632614..5633588)
Genome map
AA seq 324 aa AA seqDB search
MTAAYAKLFSTIAPKDFGRVAVLFGGLSAEREVSLKSGNAVLEALQSAGVDAFGIDVGED
FLQRLLSEKIDRAFIILHGRGGEDGSMQGLLECAGIPYTGSGILASALAMDKLRTKQVWH
SLGIPTPRHAVLCSEADCISAATELGLPLIVKPAHEGSSIGMAKVNSASELIDAWKAAST
YDSQVLVEQWIQGPEFTIATLRDQVLPPIALGTPHTFYDYDAKYIANDTQYRIPCGLDAA
KEQELMELTAKACEALGIAGWGRADVMQDADGQFWFLEVNTAPGMTDHSLVPMAARAAGL
DFQQLVLAILAASVEDAGATEARG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgactgctgcctacgccaagctgttctccaccatcgcgccgaaagacttcggccgcgtc
gccgtgctcttcggcggcctgagtgccgagcgtgaggtttcgctgaaatccggcaacgcc
gtgctcgaggcgctgcaaagcgctggcgtcgatgcgttcggcatcgatgtcggtgaggac
ttcctgcagcgtctgctcagcgaaaagatcgaccgcgcgttcatcattctccacggtcgc
ggcggtgaagacggcagcatgcagggcctgctcgagtgcgccggcatcccttacaccggc
agcggcattcttgcttccgcactggcgatggacaagctgcgcaccaagcaggtctggcac
agcctcgggattccgacgccgcgtcacgccgtgctgtgcagcgaagccgattgtatttcc
gcagcgacggaactgggcctgcctttgatcgtcaaaccggcgcatgaaggttcaagtatc
gggatggccaaagtgaattctgcgtccgagttgatcgacgcatggaaagcggccagtacc
tacgattcgcaagtcttggttgagcaatggattcaaggtccggagttcaccatcgccacc
ctgcgtgaccaggtgttgcctccaatcgccctgggtacaccgcacacattttacgactac
gacgccaagtacatcgccaacgatacccagtaccgcattccgtgcgggctggacgcggcc
aaggaacaggaactcatggaactcacggccaaggcctgtgaggcgctgggtatcgccggt
tggggccgggcggacgtgatgcaggacgccgacgggcagttctggttcctcgaagtcaat
accgcaccgggcatgaccgatcacagcttggtgccgatggcggcgcgggctgccggtctg
gatttccagcaactggttctggccattctggccgccagcgttgaagacgcaggcgcaaca
gaggcgcgaggttaa

DBGET integrated database retrieval system