KEGG   Candidatus Planktophila dulcis: A1s21155_06585Help
Entry
A1s21155_06585    CDS       T05051                                 

Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
plak  Candidatus Planktophila dulcis
Pathway
plak00010  Glycolysis / Gluconeogenesis
plak00520  Amino sugar and nucleotide sugar metabolism
plak01100  Metabolic pathways
plak01110  Biosynthesis of secondary metabolites
plak01120  Microbial metabolism in diverse environments
plak01130  Biosynthesis of antibiotics
plak01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:plak00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A1s21155_06585
   00520 Amino sugar and nucleotide sugar metabolism
    A1s21155_06585
Enzymes [BR:plak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     A1s21155_06585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ASY12585
UniProt: A0A249KEC2
LinkDB All DBs
Position
complement(1270550..1271296)
Genome map
AA seq 248 aa AA seqDB search
MSQFTLSIDCGGLFIKSCVLDESGTMHAAPTRVQTPYPLSPERFLDTVESIAKSLPKAAR
VTVGLPGMIRNGVVVATPHYINDAGPHTRMNPELKEQWWGFDAEAAVAERLGMPAKVLND
AEVHGAGVVTGSGLEIVLTLGTGLGFSVFHGGKLSPHFEMSHATVRRNTTYDTWIGDRER
HRMGNTFWSRRVRLMVSELRPVFLWDRLYIGGGNSHSIQQRDLNLMGDDVVIVPNSAGVA
GGVRAWQL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagccaattcactctctccatcgactgcggtggtctctttattaagagctgtgttctt
gatgaatcgggaactatgcacgcagctccaacgcgtgtgcagaccccatacccactttca
cctgaacgcttcctcgacaccgttgagtcaatcgcaaaatctcttcctaaggcagcgcgc
gtcactgttggtctgccagggatgattcgtaatggtgttgtagttgcaacccctcactac
atcaatgatgcaggtcctcacacacgtatgaatccagaacttaaagagcaatggtggggc
tttgatgcagaagctgcagttgctgaacgcctgggcatgccagctaaagttttaaatgat
gcagaagtacatggtgcaggcgttgtaacaggttctggtcttgaaatcgtgctcactctt
ggaacaggacttggattctctgtcttccacggcggaaagctttctccacactttgaaatg
tcacatgcaacagttcgccgaaacaccacatatgacacatggattggcgatcgcgaacgc
caccgtatgggaaatacattctggtcacgtcgcgtgcgcttgatggtctctgaacttcgc
ccagtatttctctgggatcgcctatatatcggtggcggtaattcacacagcattcaacaa
cgtgaccttaatttgatgggcgatgacgttgtgattgttccgaactctgctggagttgct
ggcggagtgcgtgcctggcagctttaa

DBGET integrated database retrieval system