KEGG   Pantoea ananatis LMG 5342: PANA5342_0349Help
Entry
PANA5342_0349     CDS       T01728                                 

Gene name
glpD
Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PANA5342_0349 (glpD)
Enzymes [BR:plf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     PANA5342_0349 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(383819..385324)
Genome map
AA seq 501 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEARDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRTGLFMYDHLGKRTSLPGS
KSLSFGAESALKPEIKRGFEYSDCWVDDARMVVLNAQEVVKHGGEVRTRTRVTRAWRENG
LWMVEAEDIDSGKTFTWQAKGLVNAAGPWVKQFFDDGLELKSPYGIRLIKGSHIVVPRVH
NEKQAYILQNEDNRIVFVIPWMDEFSIIGTTDVEYKGDPKNVAIDDNEIDYILKVYNGHF
KKQLTPDDIVWTYSGVRPLCDDESDSPQAITRDYTLDVRDDNGQTPLLSVFGGKLTTYRK
LAEHALEKLSKYYPDAGAAWTKNCVLPGGNISGSSDDYAASLRRRYPFITENMARHYART
YGSSTEVLLKDATSLEDLGENFGHEFYEAELRYLVQHEWVREVDDAIWRRTKQGMWLNEA
QQARIAEWLAAKAKPTLSLAS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagacctgatcgttatcggcggcggcatcaacggtgctggcatcgcagca
gacgctgcaggacgcggactgtcggtgttaatgctagaggcgcgggacctggcttgcgcg
acctcttccgccagctcaaagctgattcacggtggcctgcgctaccttgaacattatgaa
ttccgtctggtgagcgaagcgctggccgagcgcgaagtgctgttaaagatggcaccccat
atcgcgttcccaatgcgctttcgcttaccacaccgcccgcatctgcgtccggcgtggatg
atccgtaccggtctgtttatgtacgatcacttgggcaagcgcacgagtctgccgggcagt
aaaagcctgagctttggtgcagagtctgcacttaagcctgaaattaagcgcggttttgag
tattccgactgctgggtggacgatgcccgaatggtggtactcaatgcgcaggaagtggtt
aaacatggtggtgaggtgcgtacccgcactcgcgtgactcgcgcatggcgtgagaacggc
ctgtggatggtagaagctgaggatatcgacagcggcaaaaccttcacctggcaggccaaa
ggcctggtcaacgccgccggtccatgggttaagcagttcttcgacgatggcctggagctg
aaatcgccttacggtattcgcctgatcaaaggcagccatattgtggtgccgcgcgttcac
aatgagaagcaggcttatatcctgcaaaacgaagataaccgtattgtgtttgtcattccg
tggatggatgagttttctatcatcggcaccaccgacgtggaatataaaggcgatccgaaa
aacgtcgctattgatgataatgaaatcgactacatcctgaaggtgtacaacggccatttc
aaaaagcagctgacgcctgacgacattgtgtggacctattccggcgtgcgtccgctttgt
gatgacgagtccgattcgccgcaggcgatcactcgcgattacaccctggatgtccgcgat
gacaacggtcagacgccgctgctgtccgttttcggtggtaaattaacgacttaccgtaaa
ctggccgagcatgcgctggagaagctgtcgaagtattatcctgatgcgggcgcagcatgg
actaaaaactgcgtgctgcccggcggtaatatttccggcagcagcgacgattacgctgcc
agcctgcgccgtcgttacccgttcattactgaaaacatggcacgtcactacgcccgcact
tacggtagcagcaccgaagtgctgcttaaagatgcgacatcgctggaagacctgggtgaa
aacttcggtcatgagttttatgaggcggagttacgttaccttgtgcagcatgagtgggtg
cgtgaagtggatgacgctatctggcgccgtaccaagcaaggtatgtggctgaacgaagcc
cagcaggcacgcattgccgaatggctggcggctaaggcgaagcctacgctgtcgctggca
tcgtag

DBGET integrated database retrieval system