KEGG   Planctomyces sp. SH-PL62: VT85_05825Help
Entry
VT85_05825        CDS       T04401                                 

Gene name
icd
Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
plh  Planctomyces sp. SH-PL62
Pathway
plh00020  Citrate cycle (TCA cycle)
plh00480  Glutathione metabolism
plh01100  Metabolic pathways
plh01110  Biosynthesis of secondary metabolites
plh01120  Microbial metabolism in diverse environments
plh01130  Biosynthesis of antibiotics
plh01200  Carbon metabolism
plh01210  2-Oxocarboxylic acid metabolism
plh01230  Biosynthesis of amino acids
Module
plh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
plh_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:plh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VT85_05825 (icd)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    VT85_05825 (icd)
Enzymes [BR:plh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     VT85_05825 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AMV36929
UniProt: A0A142YCM9
LinkDB All DBs
Position
complement(1489540..1490838)
Genome map
AA seq 432 aa AA seqDB search
MASPKAEAPAGGEKITIKDGKLTVPDFPIIPFIEGDGTGPDIWRASVRVFDAAVQKAYGG
KKQIKWMEVYAGGKAHSLFNNWLPDETVDAFRDYLVGIKGPLTTPIGGGIRSLNVALRQM
LDLYVCLRPVRWFKGVPSPVKHPEKVDMVIFRENTEDVYAGIEFEAGTEDAKKLISFIKD
NFPAAYKKIRFPETSGVGVKPISSEGSERLIRSAIEYALANGRKSVTLVHKGNIMKFTEG
AFRNYGYALAEREFADQTYTWDRWEHTKAAKGEAAANAEQKAAFDSGKVLIKDAIADITL
QQILTRPTDFEVIATMNLNGDYLSDALAAQVGGIGIAPGGNINYLTGHAVFEATHGTAPK
YADLDQVNPGSVILSGEMMFRYMGWTEAADLIIKGMDGAIDQKTVTYDFARLMDGAKQVK
CSEFATAVISKM
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcccgaaagccgaggctccggcgggtggcgagaagatcacgatcaaggacggc
aagctgaccgtcccggacttcccgatcatccccttcatcgaaggcgacggcaccggcccc
gacatctggcgcgccagcgtccgcgtcttcgacgcggcggtccagaaggcgtacggcggc
aagaagcagatcaagtggatggaggtctacgccggcggcaaggcccactccctcttcaac
aactggctccccgacgagaccgtcgacgccttccgggactacctcgtcggcatcaagggg
cccctcaccacccccatcggcggcggcatccgctcgctgaacgtggccctccgccagatg
ctcgacctctacgtctgcctccgcccggtgcgctggttcaagggcgtcccctcgcccgtg
aagcaccccgagaaggtggacatggtcatcttccgggagaacaccgaggacgtctacgcc
ggcatcgagttcgaagccgggaccgaggacgcgaagaagctcatcagcttcatcaaggac
aacttccccgccgcctacaagaagatccgcttccccgagacctccggcgtcggcgtcaag
ccgatctccagcgaggggagcgagcggctgatccgctcggccatcgagtacgccctggcc
aacggccgcaagagcgtgacgctcgtccacaaggggaacatcatgaagttcaccgagggc
gcgttccgcaactacggatacgccctcgccgagcgcgagttcgccgaccagacctacacc
tgggaccgctgggagcacaccaaggccgccaagggcgaggccgcggccaacgccgagcag
aaggccgccttcgactccggcaaggtcctgatcaaggacgccatcgccgacatcaccctc
cagcagatcctgacccgcccgaccgacttcgaggtcatcgccacgatgaacctcaacggc
gactacctgtcggacgccctggccgcgcaggtcggcggcatcggcatcgcgccgggcggc
aacatcaactacctcaccggccacgccgtcttcgaggccacccacggcacggcccccaag
tacgccgacctcgaccaggtcaaccccggctcggtcatcctctccggcgagatgatgttc
cgctacatgggctggaccgaggccgccgacctgatcatcaaggggatggacggcgcgatc
gatcagaagaccgtcacctatgacttcgcccgcctgatggacggcgccaagcaggtgaag
tgcagcgagttcgccacggcggtcatctccaagatgtga

DBGET integrated database retrieval system