KEGG   Purpureocillium lilacinum: VFPFJ_07956Help
Entry
VFPFJ_07956       CDS       T05029                                 

Definition
(RefSeq) glycogen synthase
  KO
K00693  
glycogen synthase [EC:2.4.1.11]
Organism
plj  Purpureocillium lilacinum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VFPFJ_07956
Enzymes [BR:plj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     VFPFJ_07956
Glycosyltransferases [BR:plj01003]
 Polysaccharide
  Storage polysaccharide
   VFPFJ_07956
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 707 aa AA seqDB search
MASDEGAAPARDVKNHLLFEIATEVAHRVGGIYSVIKSKAPVTTAEYGDRYTLIGPLNHQ
SAAVEVEEMEPTNPEIAAAMQSMKDRGIGMLYGRWLIEGAPRVLLIDTKTAYGYMNEWKG
DLWNIASIPSPPGDDETNEAIVFGYLVAWFLGEFVVHEKKRAVIAHFHEWLAGVGLPLCK
KRRIDVTTIFTTHATLLGRYLCAGSVDFYNNLQYFDVDAEAGKRGIYHRYCIERAAAHSC
DVFTTVSHITAFESEHLLKRKPDGVLPNGLNVTKFSAVHEFQNLHQQAKEKIHDFVRGHF
YGHYDFDPENTLFLFTAGRYEFRNKGVDMFIESLARLNHRLKNANSKVTVVAFVIMPAQT
TSLTVEALKGQAVIKSLRDTTHVIEQSIGRRLFERSLKWHEGDPMPDEKELISGQDRVLL
RRRLFAMKRSGLPPIVTHNMVNDHEDPVLNQIRRVQLFNHPTDRVKIIFHPEFLNSANPV
LPLDYDDFVRGCHLGVFASYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENSSDY
GIYIVDRRTKGVDDSVNQLTSYMYDFCGKSRRQRINQRNRTERLSDLLDWKRMGMEYVKA
RQLALRRAYPGSFSGVEEDEDDYIPGVEQKISRPFSVPGSPRDRTGMMTPGDFASLQEGR
EGLSTEDYVAWKLPDEEDPDEYPFPLTLRSKQAPAETAAVEATLNGS
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atggcctccgatgaaggggccgcgccggctcgcgatgtcaagaaccacctcctcttcgag
attgccaccgaggtcgcccatcgagtcggcggcatctactccgtcatcaagtccaaggcg
cccgtcacaactgccgagtatggcgaccgctataccctcatcggcccgctgaaccaccaa
tcggctgcggtcgaggtggaggagatggagccaaccaacccggagattgctgccgccatg
cagtccatgaaggatcgcggcatcggcatgctctacggccgctggctgatcgagggcgcc
ccgagggtgctcctcatcgacaccaagacggcttacggctacatgaacgagtggaagggc
gacctgtggaacattgccagcatcccctcgccgcccggcgacgacgagaccaacgaggcc
atcgtctttgggtacctggtcgcctggttcctgggagagtttgtggtgcacgagaagaag
agggccgtcattgcccacttccacgagtggctggccggtgtcggtctgccgctctgcaag
aagcggcgcatcgacgtcaccaccatcttcacgacgcatgccacgctcctcggccgctac
ctgtgcgccggctccgtcgacttttacaacaacctgcagtactttgacgtcgacgccgag
gcgggcaagcgcggcatctaccaccggtactgcatcgagcgcgcggcggcgcattcgtgc
gacgtcttcacgaccgtctcccacatcaccgccttcgagtcggagcatctgctcaagcgc
aagcccgacggcgtcctgcccaacggcctcaacgtcaccaagttctcggccgtccacgag
ttccagaacctgcaccagcaggccaaggaaaagatccacgactttgtgcgcgggcatttc
tacggccactacgactttgacccggaaaacacgctcttcctgttcacggcgggccgctac
gagttccggaataagggtgtcgacatgttcatcgagtcgctcgcccgcctcaaccaccgc
ctcaagaacgccaacagcaaggtgacggtcgtggcgtttgtcatcatgcccgcgcagacg
acgtcgctcacggtcgaggcgctcaagggccaggccgtcatcaagtctctgcgggacacg
acgcacgtcatcgagcagagcatcggccgccggctgtttgagcggtccctcaagtggcac
gagggtgacccgatgcccgatgagaaggagctcatctccggacaggaccgcgtgctgctg
cgccgccggctcttcgccatgaagcgcagcggcctgccgccgattgtcacgcacaacatg
gtcaacgaccacgaggacccggtcctgaaccagatccgccgggtgcagcttttcaaccac
cccacggaccgcgtcaagatcatcttccaccccgagttcctcaactcggccaacccggtg
ctgccgctcgactacgacgactttgtgcgcggctgccacctgggcgtcttcgcgtcgtac
tacgagccgtgggggtacacgccggccgagtgcaccgttatgggcgtgccgagcatcacg
accaacctgtctgggttcggctgctacatggaggagctgatcgagaactcgagcgactac
ggcatctacattgtcgacaggcggaccaagggcgtcgacgactcggtgaaccagctgacg
tcgtacatgtacgacttttgcggcaagagccgtcgccagcgcatcaaccagcgaaaccga
accgagcggctcagcgacctgctcgactggaagcgcatgggcatggagtacgtcaaggcg
cgccagctggcgctgcggcgggcgtacccggggtcgttcagcggcgtcgaggaggacgag
gacgactacatccccggcgtggagcaaaagatttcgcggccgttctcggtgccgggctcg
ccgagagaccggacgggcatgatgacgccgggcgactttgccagtctgcaggagggtcgc
gaggggttgagcaccgaggactacgtggcgtggaagctacctgacgaggaggatcccgac
gagtaccccttcccgctgacgctgcggtcgaagcaagcgccggccgagacggcagccgtc
gaggccacgctgaacgggagctga

DBGET integrated database retrieval system