KEGG   Planococcus sp. PAMC 21323: Plano_1711Help
Entry
Plano_1711        CDS       T03510                                 

Definition
(GenBank) bacillolysin
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
pln  Planococcus sp. PAMC 21323
Brite
Enzymes [BR:pln01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     Plano_1711
Peptidases [BR:pln01002]
 Metallo Peptidases
  Family M4: thermolysin family
   Plano_1711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 FTP PepSY
Motif
Other DBs
NCBI-ProteinID: AIY05676
UniProt: A0A0B4RCH0
LinkDB All DBs
Position
1726844..1728505
Genome map
AA seq 553 aa AA seqDB search
MNKKKLLTLSLAASLALSATAVSANTVPTQETTEKVHVNKETQSPDMIYGKLTTPSNKSA
KEIVFTYLEQKEDLYKFGKKELSNFKVVSQDKDELGFTKLKMQQVFKGVPVFGSVINAHV
DQDGVLTSVSGNLTPELYDKQSLKKGATLKADAALEKAKAALTKKIGSSPELESEVTPEL
VVYYKDGNANYAYSAEFEFLYPEPGNYQYIIDAKTGEILDSYNQIHEAKPSSGGPSLTGS
DTTGTGKGVLGDTKTFNTLTNSSGSYLVDRTRGNGIFTYDAKNRTRTPGTLWLDSDNVYN
AAYDGAAVDAHAYAGQTYDYFKNVHNRNSYDGNGADLVSTVHYGRNYNNAFWSGSQMVYG
DGDGNTFVPLSGALDVIAHELTHAVTDTTADLIYQNESGAINESMSDIFGTLVEYHFNNN
PDWQVGEDIYTPNIAGDALRSMQDPTLSGDPDHYSKRYTGTGDNGGVHINSGISNKAAYL
LANGGTHYGVSVNAIGNNKAGAIYYRTLTQYLTPNSNYSHFRVSTIQAATDLYGASSAEV
ASVKAAFTAVGVN
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagaaaaaattactgactttaagtttggcagcatcactagcgttatcagcaact
gcggtttccgcaaataccgtccctacacaagaaacaacagaaaaggttcatgtcaataaa
gaaacacaatcgcctgatatgatttatggaaaacttacgactccatccaataaatctgcc
aaggaaattgtgtttacatatttggaacaaaaagaagatctctataaattcggcaaaaag
gaactttctaattttaaagttgtcagccaagataaagatgagcttggctttacaaaactg
aaaatgcaacaagtgtttaaaggcgttcctgtatttggatcggtgattaatgcgcatgta
gaccaagatggtgtgttaacttctgtttcagggaatttaaccccggaattatatgataag
caatcattgaaaaaaggtgcgactttaaaagcagatgcagcacttgaaaaagcaaaagct
gccttaactaaaaaaattggcagttctccagagcttgaatctgaagtgacacctgaatta
gttgtttactacaaagatggtaatgcaaattatgcatacagtgcagaatttgaattcctg
tatccggaacccggcaactatcagtatattattgatgctaaaacaggagaaattttagat
tcgtacaatcaaatccatgaagcaaagccctcgtctggcggtcctagcttaactggtagc
gacacaactggtacaggtaaaggagttttaggagacaccaaaacctttaataccttgact
aacagcagcggttcttatttggtggatcgaactcgtggaaatgggattttcacatacgat
gctaaaaatcgtacacggacaccaggtactttatggcttgatagcgataatgtttataac
gctgcatatgatggtgctgctgtagatgcacatgcttatgcaggtcaaacatatgactac
ttcaaaaatgtccacaaccgcaatagttacgatggcaacggagccgatttagtatctaca
gtccattatggccggaactacaacaatgctttctggagtggatctcaaatggtgtacggt
gatggtgacggcaatacatttgtcccgttatccggtgcacttgatgtaatcgctcatgaa
ctgacacacgctgtaacagatactacggcggacttaatttatcaaaacgaatcaggcgca
attaacgagtcaatgtctgatatttttggaactttagttgagtaccatttcaataacaat
ccggattggcaagttggagaagatatttatacgccgaatattgcaggtgatgcacttcgc
tcaatgcaagatccaactttaagtggtgatcctgatcattattcgaaacgttatactgga
acaggcgataacggcggcgttcacattaattctggaattagtaataaagcggcatattta
ttagctaacggcggtacgcattatggtgttagtgtaaacgcgattggcaataataaagcg
ggcgctatttattaccgcacattaactcaatatttaacgcctaactcaaactatagtcat
ttccgcgtttcgacgatccaagcagcaactgatctttatggagcttcgagtgcagaagtt
gcaagtgtcaaagctgcatttacagctgtaggagttaattga

DBGET integrated database retrieval system