KEGG   Pleurocapsa sp. PCC 7327: Ple7327_1687Help
Entry
Ple7327_1687      CDS       T02367                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:plp00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ple7327_1687
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Ple7327_1687
   00680 Methane metabolism
    Ple7327_1687
Enzymes [BR:plp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Ple7327_1687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1808562..1811588)
Genome map
AA seq 1008 aa AA seqDB search
MSSLLRPSVPDVSIFSTSELLLRHRLKLVEDLWESALRSEYGQEAVDLLKKLRSICSPEG
QATEIPASAIAQTIEQLELNQAILASRAFALYFQLINIVEQHYEQRDRQLERLASSQDSS
DLSQHGSQLDNINTPPAALGVNLLEKSFFNENANAPKAGTFQWLFPYLKQLNVPPQLIQR
LLNQLDIRLVFTAHPTEIVRHTIRKKQRRIARILRQLDRAEEAFRAIGLSTSWEAEEAKA
QLTEEIRLWWRTDELRQFKPTVLDEVDYALHYFEEVLFEVIPQLSIRLKQALKSAFPRLT
APANDFCRFGSWVGGDRDGNPSVTPEVTWKTACYQRNLVIEKYLQSVRELIVVLSPSLHW
SNVSQDLLDSLERDKMQLPEIYEQLAIRFRQEPYRLKLSYIQKRLENTRDRNKRLAIPEE
RQILFQRFHDNVYRCGDDFLAELRLIQRNLAETRLCCQELDNLICQVEVYGFNLAQLDFR
QESSQHSEAIEEIAEYLQILPKPYSQLTEAEKIAWLVQELRTRRPLIPQDMPFSAKTCEA
IETLRILRQLQQEFGLDICQTYIISMTHDASDVLEVMLLAKEAGLYDPATGQTTLRICPL
FETVDDLRRAPTIMEELFEIPLYRTALAGGHDGIEIPGFPVNLQEVMVGYSDSNKDSGFL
SSNWEIHKAQKALQKVARKYGVILRLFHGRGGSVGRGGGPAYAAILAQPSSTINGRIKIT
EQGEVLASKYSLPELALYNLETLATAVIQSSVLGSGFDDIEPWNAIMEELATCARKAYRA
LIYEQPDFIDFFLSVTPIPEISQLQISSRPARRKSGQKDLSTLRAIPWVFSWTQSRFLLP
AWYGVGTALREFLAREPEENLKLLRYFYLKWPFFKMVISKAEMTLAKVDLQIAHHYVREL
SKPEDRERFERLFEQIAQEYHLSCDLILTITEHNRLLDGDPSLQRSVQLRNGTIVPLGFL
QVSLLKRLRQYSDRASSNAIYFRYSKEELLRGALLTINGIAAGMRNTG
NT seq 3027 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgttgcttcgcccgtccgtcccagacgttagcatcttctccacgtcagaactt
cttttgcgccatcgtctcaaattagtcgaagatttgtgggaatctgcgctgcgctccgaa
tatggacaagaagccgtcgatttactcaaaaaattgcgatcgatttgttcgccagaagga
caggcaacagaaattcctgcctccgcgatcgcgcaaacgatcgaacagctcgaactcaac
caagccattctggcatctcgtgcctttgccctctatttccaactgatcaacattgtcgaa
cagcactacgagcaacgcgatcgacagcttgagaggctggcttcttctcaagactcgagc
gacctcagtcaacatggcagccaattagacaatatcaatactcctcccgcagcgctggga
gtcaacctcttagaaaaaagtttcttcaacgaaaatgccaacgcgcccaaagcaggaacc
tttcaatggctttttccctatctcaaacaactaaacgtaccaccccagttaattcagcga
ttgctcaaccaactcgacattcgccttgtctttaccgctcaccccactgaaatcgtgcgc
cacaccattcgcaaaaaacaacggcgaatcgctcgcattctgcgccagctcgatcgcgcc
gaagaagcatttcgagccataggattgagtacttcctgggaagccgaagaggctaaggcg
caactgacggaagaaattcgcctctggtggcgaaccgacgagctgcgccagttcaaaccc
actgttttagacgaagtcgattacgctctgcattactttgaagaagttttatttgaagtc
attccgcaactgtcgatacgtctcaaacaagctctcaaaagcgcctttcccagattaact
gcgccagccaatgatttctgccgttttggctcctgggttggaggcgatcgcgacggcaac
ccctcggtcacacccgaagtgacttggaaaaccgcttgctatcagcgcaatctcgtcatc
gaaaaatatctgcaatcggtgcgggaattaatcgttgtcttgagtccgtctctgcattgg
agtaacgtatcccaggacctgctcgactcgctagagcgggataagatgcaactgcccgaa
atttacgagcagttagccatccgctttcgtcaggaaccctatcgactcaagctctcctac
atccaaaaacggctggaaaatacccgcgatcgcaacaagcgcctcgccattcccgaagag
cgccaaatcctcttccaaaggtttcatgacaatgtctatcgttgcggggacgattttttg
gcagaattacggttaattcagcgcaatttggctgaaacgagattgtgctgtcaggagcta
gacaatctgatctgtcaggtcgaagtctatggctttaacctcgcccaactcgattttcgt
caagagtcttcccaacactctgaggcgatcgaagaaatcgccgagtatctgcaaattctg
cccaaaccctacagccaactcacagaagccgagaaaatcgcctggctggtgcaagagttg
cgcacgcgccgcccattgattccccaagacatgccattttcagccaaaacctgcgaggcg
atcgaaaccctgcgaattttgcggcagttacagcaggagttcggtttagacatctgccaa
acttacattatcagcatgacccacgatgccagcgacgttttggaagtaatgctgctggca
aaagaagccggactctacgatcccgcgactggtcagacgacgttgcgaatttgcccttta
tttgaaacggtagacgacctcagacgagcgccgaccatcatggaagaattgtttgagatc
cctctctaccgaactgctctggcaggaggtcacgacggaattgaaatcccagggtttcct
gtcaatcttcaagaagtcatggtcggttactcggatagtaataaggattcgggttttctc
agtagcaattgggaaattcataaagcgcagaaagctctacagaaagtggctcggaaatat
ggagtcatactgagactgtttcacggacgcggcgggtcggtcggtcgtggtggcggacct
gcttatgcagctatcttggcacagccttcctcgactatcaacggacgaatcaagattacc
gaacagggagaagtcctcgcctctaagtattccttacccgaactggcgctctataatcta
gaaacgctcgccactgctgtcattcaatcaagcgtgttgggaagcggttttgatgatatc
gagccgtggaacgcaattatggaggaattggcaacctgcgcgcggaaagcctatcgcgct
ctgatttacgaacagccagattttatcgatttctttctctcggtcactcccatcccagaa
atcagccaactacaaattagttctcgtcccgccagacgcaagagcggtcaaaaagacctc
agtaccttaagagctatcccttgggtctttagctggacgcaaagccgcttcctgttgcct
gcttggtacggtgtcgggacggctttacgagaatttctcgctcgcgagccagaggaaaat
ctcaagttgctgcgttatttttacttaaaatggcccttctttaagatggtcatttccaaa
gcggaaatgacattggctaaggtagatttacagattgcgcatcattacgttagagaacta
tcaaaacctgaagatagggaacgtttcgagcggcttttcgagcaaatcgctcaagaatat
caccttagttgcgatttaatcctgacaattacagagcacaatcgacttctagacggcgat
cccagcctgcaacgatcggtgcagttgcgcaatggtacgatcgtgccattaggcttcctg
caagtttctttactcaaacggcttcgccagtatagcgatcgcgcttcatcgaacgccatc
tatttccgttacagtaaggaagagttactgcgcggcgccttgttaaccattaatggaatc
gccgccggaatgcgcaatactggttaa

DBGET integrated database retrieval system