KEGG   Pleurocapsa sp. PCC 7327: Ple7327_3209Help
Entry
Ple7327_3209      CDS       T02367                                 

Definition
(GenBank) nitrate ABC transporter, permease protein
  KO
K15577  
nitrate/nitrite transport system permease protein
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
Nitrogen metabolism
ABC transporters
Module
Nitrate/nitrite transport system
Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:plp00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Ple7327_3209
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Ple7327_3209
Transporters [BR:plp02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    Ple7327_3209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3457972..3458811)
Genome map
AA seq 279 aa AA seqDB search
MTANLRTRSQNNILASLLPVLQKSPRKVIAPIVAIAIFLIVWQILAGGSKSGIPAPLTIL
QETWNPLIINPFFDNGGTDKGLFWQILASLQRVGIGFSLSAIVGIGLGILIGSNRLMFDA
LDPIFQVLRTVPPLAWLPISLTAFSQANPSAIFVIFITAIWPIIINTTVGVQQIPRDYQN
VSRVLQLSKVEYFFNILFPSTVPYIFTGLRIGIGLSWLAIVAAEMLVGGVGIGFFIWDSY
NSGRLSPLILALVYVGIVGFLLDRLVGFIASLVVPEEQK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgactgctaatctacgaactcgttcccaaaataatatattggcttctctgttacctgtc
ctgcaaaaatcgcccagaaaagttattgcgcccattgtagcgatcgcaattttcttaatc
gtttggcaaattttagccgggggatccaagtctgggattcccgcacctttaacgattctc
caagaaacttggaatccgctcatcatcaatcctttctttgacaacggcggaacggataaa
gggttattttggcaaattttagccagcttgcaaagggttgggattggcttctctctatcc
gctattgttgggattggtttgggcattttgattggttccaatcgcctgatgttcgatgct
ctagacccaatttttcaagtgttgcgaaccgttccccctttagcttggttgccgatttct
ttaacggcatttagtcaggcaaacccttccgctattttcgtgattttcattacagcaatt
tggcccatcattatcaatactacggtaggagttcaacaaattcctcgcgattaccaaaac
gtctcgcgagttttgcaactctctaaagttgagtattttttcaatattctttttccctca
accgttccgtatatttttacggggttgcgcattgggattggtctatcttggctggcaatc
gtcgctgctgaaatgttggtaggcggcgttggcatcggcttctttatttgggattcctac
aatagcggccgtctcagccccttaattctcgccctcgtctacgtcgggatcgttggtttc
ttactagatcgattggttggctttattgctagtctcgtcgttcccgaagaacagaagtaa

DBGET integrated database retrieval system