KEGG   Pleurocapsa sp. PCC 7327: Ple7327_3579Help
Entry
Ple7327_3579      CDS       T02367                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
plp00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:plp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Ple7327_3579
Enzymes [BR:plp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Ple7327_3579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AFY78779
UniProt: K9T9W8
LinkDB All DBs
Position
3816241..3817737
Genome map
AA seq 498 aa AA seqDB search
MQTSPLTCLNYIDGQWLPARTKDTAESRNPADWRELVATFPRSTDSDVDAAVDAARRAYK
TWRLVPAPARAELVYRAGELLLDKKEEIAYLMSREMGKPLSETRGDVQEGIDCAFYYAGE
GRRLFGVTTPSELNNKFAMSVRMPVGVCALITPWNFPMAIPCWKAMPALVCGNTIILKPA
KDTPACATLLVEIFHEAGFPPGVVNLVHGSGGEVGRALVNHPGIDLISFTGSSKSGAEVG
EICGRTHKRVCLEMGGKNAQVVMEDADLELALEGALWGAFGTTGQRCTATSRLILHREIK
AKFTDMLLEKTAKLRLGHGIDPKTDVGPLINSSQRERVRRYIEIACEEGAKVLIGGDIGK
EEELQYGYFFQPTILDEVTPQMRVAREEIFGPVVSLIEVNSFEEAIAVLNDTPYGLSSSV
YTRDVNRAFQAMRDIEAGITYINGPTIGAEVHLPFGGVKQTGNGHREAGSAALDVFTEWK
TVYVDFSGRLQRAQIDNR
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacttctccccttacttgcctcaactatatcgacggtcaatggctccccgcgcga
accaaagacaccgcagaaagtcgcaatcctgccgattggcgagagcttgtcgctaccttt
ccccgttctaccgatagcgatgtcgatgcggcggtagatgctgcccgtcgcgcctataaa
acctggcgcttagtacccgcaccagcaagggcagaattagtctatcgcgcgggcgaacta
ttgttggacaaaaaagaagaaattgcctatctgatgtctcgcgagatgggcaaaccgttg
tctgagacgcgaggagacgtacaagagggaattgattgcgctttttactacgctggcgaa
ggtcgccgtttgttcggggtgacaacgccgtcggaactcaacaacaagtttgccatgtcg
gtgcggatgccagtcggcgtttgcgccttgattacgccttggaactttcccatggcgatt
ccctgttggaaggcaatgcccgcgctggtttgcggcaataccatcatcctcaaaccagca
aaggatacgcctgcttgcgccactctattagtagaaattttccacgaggcaggttttccg
cctggagtcgttaacctagtacacggttctggcggagaagtcggtcgagcattggtaaac
catcctgggattgatttaatttcctttacgggttcttctaaatcgggtgcggaagtcgga
gagatttgcggacgcactcacaagcgcgtctgtctggaaatgggtggtaagaatgcccaa
gtcgtcatggaagatgcggatttagaattggcactcgaaggggcgctttggggggctttt
ggtacgaccggacagcggtgtactgcgaccagtcgcttgattttgcaccgcgaaatcaaa
gccaagtttactgatatgctgttggagaaaacagctaagctgcgcttaggtcacggcatc
gacccaaaaacggatgtaggtcccttaattaattcgtcacaacgagaacgggttagacga
tatatagaaattgcttgcgaggaaggagcaaaggtgttaatcgggggagacattggtaaa
gaagaagaattgcaatacggttattttttccaaccaaccatattggatgaagttactcct
cagatgcgagttgctcgcgaagagatttttggtccggtggtatctttgatagaagtgaat
tcgtttgaggaagcgatcgcagttctcaacgatacgccttacggactgtcttcttctgtt
tatactcgcgacgtgaaccgagcttttcaggcaatgcgggatattgaagctggcattact
tatatcaatggtcccactatcggcgcagaagtccatcttccttttggtggcgtgaagcag
acaggcaacggtcatcgcgaagcgggtagtgcagcgcttgatgtctttacggaatggaag
acggtttatgtcgatttttccggtcgcttgcaacgcgctcagatcgataatcggtag

DBGET integrated database retrieval system