KEGG   Photorhabdus luminescens: plu0432Help
Entry
plu0432           CDS       T00149                                 

Gene name
tufB
Definition
(GenBank) translation elongation factor EF-Tu.B
  KO
K02358  elongation factor Tu
Organism
plu  Photorhabdus luminescens
Brite
Translation factors [BR:plu03012]
 Eukaryotic Type
  Elongation factors
   plu0432 (tufB)
 Prokaryotic Type
   plu0432 (tufB)
Mitochondrial biogenesis [BR:plu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    plu0432 (tufB)
Exosome [BR:plu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   plu0432 (tufB)
  Exosomal proteins of breast cancer cells
   plu0432 (tufB)
  Exosomal proteins of colorectal cancer cells
   plu0432 (tufB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Lsm_C
Motif
Other DBs
NCBI-ProteinID: CAE12727
Pasteur: plu0432
UniProt: Q7N9B1
LinkDB All DBs
Position
459158..460342
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERKKPHVNVGTIGHVDHGKTTLTAAITTVLAKTFGGNARAFDQIDNAPEEKARG
ITISTSHVEYDTPSRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPVIRGSALKALE
GDAEWEAKIIELAEALDSYIPEPERAIDQPFLLPIEDVFSISGRGTVVTGRVERGIVKVG
EEVEIVGIKDTTKTTCTGVEMFRKLLDEGRAGENVGVLLRGTKRDEIERGQVLAKPGSIK
PHTTFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIQMK
VTLIAPIAMDQGLRFAIREGGRTVGAGVVAKVIA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaagaaaaatttgaacgtaaaaaaccgcacgttaacgttggtactatcggccac
gttgaccatggtaaaactaccctgactgctgccatcactactgtactggctaaaaccttc
ggtggtaacgctcgcgcattcgaccagattgataacgcgccagaagaaaaagcgcgtggt
atcaccatctctacttctcacgtagaatatgatacgccaagccgtcactatgcgcacgtt
gactgcccaggccacgccgactacgtgaaaaacatgatcaccggtgcggctcagatggac
ggcgcaatcctggtagttgccgcgactgacggtccaatgccacagacgcgtgagcacatc
ctgttaggccgtcaggtaggcgttccttacatcatcgtgttcctgaacaaatgtgacatg
gtagacgacgaagagctgctggaactggttgagatggaagtgcgtgagctgctgtctcag
tacgatttcccaggcgacgacacgccagtcatccgtggttctgctctgaaagcgctggaa
ggtgatgcagagtgggaagccaaaatcatcgaactggcagaggccctggatagctacatt
ccagagccagagcgtgctattgaccagccattcctgctgccaatcgaagacgtattctct
atttcaggccgtggtactgtagttaccggtcgtgtagagcgcggtatcgttaaagtgggt
gaagaagttgaaatcgtgggtatcaaagacacgactaaaaccacttgtactggcgtagaa
atgttccgcaaactgctggacgaaggccgtgcaggtgagaacgtcggtgttctgctgcgt
ggtaccaagcgtgacgaaatcgaacgtggtcaggtactggcgaaaccgggttcaatcaag
ccacacaccactttcgaatcagaagtttatattctgagcaaagacgaaggtggccgtcat
acgccattcttcaaaggctaccgtccacagttctacttccgtacaactgacgtgaccggt
accattgaactgccagaaggcgtggaaatggtgatgccaggtgataacattcagatgaaa
gttaccctgattgccccaatcgcaatggaccagggtctgcgttttgctatccgtgaaggt
ggccgtacagtaggtgctggtgttgttgctaaagttatcgcataa

DBGET integrated database retrieval system