KEGG   Photorhabdus luminescens: plu1865Help
Entry
plu1865           CDS       T00149                                 

Definition
(GenBank) unnamed protein product; Truncated gene. Some similarities with putative phosphoenolpyruvate phosphomutase
  KO
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
plu  Photorhabdus luminescens
Pathway
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:plu00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    plu1865
Enzymes [BR:plu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     plu1865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
LinkDB All DBs
Position
2210256..2210996
Genome map
AA seq 246 aa AA seqDB search
MRCGMSALTDSAVKGIPDNETLDINSRLQNIHEIKLLTKMPVIMDADTGGRVEHFVHYVR
KMEQVGIDAVIIEDKTGNKRNSLFGTSVKQELADIKEFSNKIAKGKAAQQKSRLMIFARL
ESLIAGYGMEDALERANAYVKAGANGIMIHSCQNTSDEVIDFSQSFRKKYPKLPLICVPT
TYSATYHHDLSEAGFNIIIYANHMLRAAYKAMEHVSHEILKYGRSAEVEKDCISIKKVIN
LIPYAS
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcggtgcggaatgtcggctttaactgactcagctgttaaaggtattcctgataacgaa
acattggatattaatagtcgtttacaaaatattcatgagataaaattactcactaaaatg
ccggttattatggatgctgacacaggtggacgggttgagcattttgtccattatgtcaga
aaaatggagcaggtaggtattgatgcagtcattattgaagataaaacgggcaataaaagg
aattccctgtttggcaccagtgttaaacaagaattggctgatattaaagaattcagtaac
aaaatagctaaaggtaaagctgcacaacaaaagagccgattaatgatttttgcacgactg
gaaagtttaattgctggttacggaatggaagatgcattggagagagccaatgcctatgtt
aaagcaggtgctaatggcattatgatccatagctgccagaatacgtctgatgaagttatt
gattttagtcagtcattcagaaagaaatatccaaaattaccactgatatgtgtaccaacg
acttattcagcaacttatcatcatgatctgagcgaagcaggttttaatattattatttat
gccaaccatatgctcagagcggcttataaagcaatggaacatgtatctcacgaaatatta
aagtatggacgttccgcagaagtagagaaagattgcataagtataaaaaaagtcatcaat
cttattccttatgcatcttga

DBGET integrated database retrieval system