KEGG   Paenibacillus larvae: ERIC2_c04300Help
Entry
ERIC2_c04300      CDS       T02963                                 

Gene name
alr
Definition
(GenBank) alanine racemase Alr
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
plv  Paenibacillus larvae
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:plv00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    ERIC2_c04300 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    ERIC2_c04300 (alr)
Enzymes [BR:plv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     ERIC2_c04300 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:plv01011]
 Precursor biosynthesis
  Racemase
   ERIC2_c04300 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
437707..438894
Genome map
AA seq 395 aa AA seqDB search
MDVYYRPTWVEVSLDALSGNLQAFRQALPDSIRIMAVVKADAYGHGAASIAREAIASGAD
HLAVAFLDEALQLREAGISAPILVLGYTAPDGLEMALKNNITLTVFNEEMLRGMELLQGQ
AEALDKRLRVHVKVDSGMHRIGLYKEEEAVSYLKQIARMPHICLEGLFTHYACADEADKA
YTRLQYEKFSRVVHEVKRLGIDIPYIHAGNSAAAIDTPELVYNMARLGIAMYGLYPSEKV
DHTIIKLEPVMSLKTRMIHDKWLSEGSGISYGTIYHTKGEERIGTLPIGYADGFSRMLST
KANALIRGKRVPIVGRICMDQCMLNITGVPEAEAGDEVVLIGRQGDEVIPAEEIAGHLGT
INYEVTCMMAHRIPRVYVKEGRIVEVKNVLHHHST
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
gtggatgtatattatcgccctacatgggtagaagtttccctggatgcgctctccggcaat
ttgcaggctttccggcaggctttaccggattcgatacggataatggctgttgttaaagcg
gatgcttatggacacggagcggcaagtattgcccgggaagccattgcttcgggagccgat
catttggcagtagcctttctggatgaagcgttgcagctccgggaagcagggatttcagcc
ccaatcctggtattgggatatactgctccggacgggttagaaatggctctgaaaaacaat
attacgttaaccgtatttaatgaagaaatgctaagaggaatggaactccttcagggacag
gctgaagctctggataagaggctccgcgttcatgtaaaagtggacagtggcatgcaccgg
atcggcctgtacaaagaggaggaggccgtctcctatctgaaacagattgcccggatgccc
catatttgtttggaaggactttttactcattatgcctgtgccgacgaggcggacaaggca
tatacgcgcctgcagtatgaaaagttttcccgagttgtgcatgaagtgaagcgccttgga
atagacataccttatattcatgcgggaaatagtgcagccgctatagataccccggagctc
gtttataatatggcacggttgggaattgccatgtatggattatacccctctgaaaaggtg
gatcataccatcattaagcttgaacccgttatgtctttgaaaacccggatgattcatgat
aaatggctatctgagggttcaggtatcagttacggtacgatctatcacacaaaaggagaa
gaacggatcggcacacttccgatcggatatgccgacggattttcgagaatgttgtcgact
aaggcaaacgcgcttatccggggaaagcgggtccctatcgtcggacgtatttgtatggat
cagtgcatgctcaatataaccggggtaccggaagctgaagccggtgatgaagtggtgctt
ataggaagacagggggatgaagtcattcccgctgaggaaatagccgggcatctgggcacg
atcaattatgaagtaacctgtatgatggctcatcgtataccgcgtgtctatgttaaggaa
gggcgcatcgttgaggtgaaaaatgtacttcaccaccactcaacatag

DBGET integrated database retrieval system