KEGG   Prochlorococcus marinus SS120: Pro_0401Help
Entry
Pro_0401          CDS       T00137                                 

Gene name
aceF
Definition
(RefSeq) Dihydrolipoamide S-acetyltransferase
  KO
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pma  Prochlorococcus marinus SS120
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pro_0401 (aceF)
   00020 Citrate cycle (TCA cycle)
    Pro_0401 (aceF)
   00620 Pyruvate metabolism
    Pro_0401 (aceF)
Enzymes [BR:pma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Pro_0401 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
384875..386257
Genome map
AA seq 460 aa AA seqDB search
MASHDIFMPALSSTMTEGKIVEWLKQPGEKVSRGESVLVVESDKADMDVESFQDGFLAAV
LMPSGSTVPVGETIGLIVETEAEIPAVQAANPTKSNVSPPENLSVSKDSKQTSDDSKQTP
EDKPSTAEPFTSPKASSASLPAKAIINQGRIVATPRAKKLSTQLGVDLATVSGTGPHGRI
QAEDVQKAQGQPITVPWIAESNAPASIPTAPSVVVTESSRNRSQPVEVPKGNSFGNPGET
IPFNTLQQAVNRNMEMSLSVPCFRVGYAITTDKLDAFYKQVKPKGVTMTALLAKAVGKTL
ARHPQLNAAWSNEGMTYPKQINVAVAVAMEEGGLITPVLQNADLTDLFELSRQWADLVKR
SRTKQLQPNEYNSGTFTLSNLGMFGVDRFDAILPPNTGGILAVAASLPKVIAGRDGSISV
KRQMQVNLTADHRVVYGADGASFLKDLANLIENNPESLSS
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
ttggcaagtcacgacatttttatgccagctcttagttcgactatgactgagggaaagatt
gttgaatggttaaagcaaccaggagagaaagtctctcgcggtgagtcagtacttgttgtt
gaatctgataaagctgatatggatgttgagtcatttcaagatggcttcctggccgcggtt
ttaatgccctcaggaagcactgtgccagtaggagaaacgattggcttgatagttgagact
gaagcggaaatccctgcagttcaggccgctaacccaaccaaaagtaatgtttcgcctcca
gagaatctttctgtttctaaagactccaaacaaacttcagatgattccaaacaaactcct
gaagataagccctctacagctgaacctttcacttctccaaaagcatcaagtgcatcattg
cctgctaaagcaataatcaatcaaggtcgaatcgttgcaacacctcgtgcaaaaaaactt
tctactcaacttggggttgatcttgcaaccgtttctggtactggtccacacggaagaatc
caagcagaagatgtccaaaaggctcaagggcaaccaataactgttccatggattgctgaa
agcaatgcgcctgcctctattccaactgcaccatcagttgttgtcactgagagttctagg
aatagatcgcagccagttgaagttccaaaaggcaatagttttggaaatcctggcgaaact
atcccatttaatacccttcagcaggcagtcaataggaatatggagatgagtttgtctgtt
ccttgtttcagagtagggtatgcaattacaacagataagcttgatgccttttataagcaa
gtaaagcctaagggtgtaactatgacagcgttgttggcaaaagctgttggcaagactctt
gcaaggcaccctcagctaaatgcagcttggagcaatgagggaatgacatatccaaaacaa
attaatgttgcagtagcagtggcaatggaagaaggaggtcttattacccctgtccttcag
aatgctgatctcacagatttgttcgaattatcacgtcaatgggctgatttggtcaaacgt
tctagaaccaagcaacttcaaccaaatgaatacaatagcgggacatttacactttcaaat
ttgggtatgtttggagtagatcgttttgacgcgatacttcctcctaatacaggaggcatt
ttggcagttgcagcgtctctccctaaagtcatagcggggagagacggatccatttcagtt
aagcgtcaaatgcaagtaaatctaactgctgaccatcgagttgtttatggtgcagatggt
gcttctttcttaaaagatcttgctaatttaattgagaataatcctgaaagcctttcttct
tga

DBGET integrated database retrieval system