KEGG   Papilio machaon (common yellow swallowtail): 106710084Help
Entry
106710084         CDS       T05138                                 

Definition
(RefSeq) alpha-amylase 1-like
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
pmac  Papilio machaon (common yellow swallowtail)
Pathway
pmac00500  Starch and sucrose metabolism
pmac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmac00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    106710084
Enzymes [BR:pmac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     106710084
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase Alpha-amylase_C
Motif
Other DBs
NCBI-GeneID: 106710084
NCBI-ProteinID: XP_014357550
LinkDB All DBs
Position
Unknown
AA seq 500 aa AA seqDB search
MIRFILLLAAAGLAVAFKNPHYVSGRTTMVHLFEWKWDDIAAECERFLGPRGFAGVQISP
PNENLVIRSKNRPWWERYQPMSYRLVTRSGNEQQFANMVRRCNNVGVRIYVDAIINHMTG
TWNENVGTGGSTANFGNWHYPAVPYGRNDFNSPQCVISGNDYRCCPDRVRNCELSGLKDL
NQGSTHVRNMIVNYMNHLINLGVAGFRIDAAKHMWPGDLRAIYNRLNNLNRNHGFPSGAR
PYIYQEVIDLGGEAISRNEYTSLAAVTEFRFGMELSRAFQGGNQLRWLSNWGPNWGLLAS
GDALAFIDNHDNQRGHGAGGNILTYKSAKRYKGAIAFMLAHPYGQPQLMSSFDFRDTEAG
PPQDRNGNIISPSINSDGSCGNGWICEHRWRQIYQMVAFRNIAGNTGVNNWWDNGSNQIA
FCRGQQAFIAFNNDNWDLNQDLNTCLPAGNYCDVISGVKNGNRCTGKTISVNSNGRARIT
IRSNDYDMILAIHRGSESRL
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgattcggttcattctgttgttggctgctgcgggcctggccgtggcctttaagaatcct
cactatgtctccggccggactactatggttcatctctttgaatggaagtgggatgatatc
gctgctgagtgcgaaaggttccttgggcctagaggtttcgctggtgttcagatatcaccg
cccaatgaaaatttggtaatcaggtcaaaaaaccgaccatggtgggagagatatcagccg
atgtcttacagattggtaacacgttctgggaatgagcagcagttcgctaacatggtgcgt
cgttgcaataacgtgggtgtcaggatatatgttgatgccatcattaaccatatgactggt
acttggaacgagaacgtgggcaccggaggcagcactgctaacttcggaaactggcactac
ccagccgtaccttacgggagaaatgacttcaattcacctcaatgtgtaatctctggaaac
gattatcgctgctgtccagatagggtaagaaactgtgagctttcaggattaaaggacttg
aatcaaggatctacccatgttcgtaacatgattgtaaattacatgaaccacctcattaat
ctcggagtagcaggctttaggattgatgctgccaagcacatgtggcctggagatctccgc
gctatctacaacaggcttaacaatctaaataggaaccatggttttccatctggcgcccgg
ccttatatctaccaagaagttatcgatcttggtggtgaagctattagtcggaatgaatat
acatcactggctgcagtcactgagtttagattcggaatggaattaagcagggccttccag
ggcgggaatcaactgaggtggttaagtaattggggacctaactggggtctgcttgcaagc
ggtgatgctttggcatttatcgataaccacgataaccagagaggccacggtgccggtggt
aatattcttacatacaaaagtgcaaaacgatacaagggagcaatcgcttttatgttggcc
catccatacggccagcctcagttgatgagcagttttgatttccgtgacactgaagctgga
cccccacaggaccgcaacggcaatattatttctccttctattaattccgacggctcgtgc
ggtaacggatggatctgcgaacatcgctggcgtcaaatctaccagatggttgcgttcaga
aatattgccggcaatactggtgtgaacaactggtgggacaacggcagcaaccaaattgcc
ttctgccgcggtcagcaagcattcattgctttcaacaacgacaactgggatcttaaccaa
gacttaaacacttgtctaccagctggcaattattgtgatgtcatatctggtgtgaagaac
ggcaacagatgcaccggcaagacaatctcagttaacagcaatggccgtgcccgtatcacc
atacgctctaatgattacgacatgattcttgccattcatcgtggcagtgagtcaagactg
taa

DBGET integrated database retrieval system