KEGG   Papilio machaon (common yellow swallowtail): 106711737Help
Entry
106711737         CDS       T05138                                 

Definition
(RefSeq) glutathione S-transferase 1-1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pmac  Papilio machaon (common yellow swallowtail)
Pathway
pmac00480  Glutathione metabolism
pmac00980  Metabolism of xenobiotics by cytochrome P450
pmac00982  Drug metabolism - cytochrome P450
pmac00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:pmac00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    106711737
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    106711737
   00982 Drug metabolism - cytochrome P450
    106711737
   00983 Drug metabolism - other enzymes
    106711737
Enzymes [BR:pmac01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     106711737
Transporters [BR:pmac02000]
 Other Transporters
  Pores ion channels [TC:1]
   106711737
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4 Cpn60_TCP1
Motif
Other DBs
NCBI-GeneID: 106711737
NCBI-ProteinID: XP_014359621
LinkDB All DBs
Position
Unknown
AA seq 215 aa AA seqDB search
MPIDLYYVPGSPPCRAVLLTARALNLNLNLKLVDLHHGEHLKPEYVKLNPQHTVPTLVDD
GLALSESRAIITYLVNKYGKASGLYPEEARARALVDQRLYFDIGTLYQRFSEYFYPQVFA
GAPADKEKAAKVEDALKILDVFLEGQKYVAGAGLTVADLSLIASVSTFEASDIDFKKFAN
VKRWYETVKTTAPGYQEANEKGLDAFKALVSSMKK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgcctatcgacttgtactacgtgccagggtcaccgccatgccgcgccgtgctcctgacc
gctcgggctctcaacctcaacctgaacctcaagctggtcgacttgcaccacggcgagcat
ctcaagcctgaatacgtcaagttgaacccgcaacacacagtgccgacactagtagacgac
gggctggcgttgagcgagtctcgcgctattattacctacctggttaacaagtacggcaag
gcgagcggcctgtatccggaggaggcccgcgcgcgcgctctcgtagaccagcgcctgtac
tttgacatcggcaccctctaccagcgctttagtgaatacttctacccacaagtgttcgcg
ggtgctccagcagacaaggagaaggcggccaaggtggaggatgccttgaagatcctggac
gtgttcctagaggggcaaaagtacgtagcgggagccggcctcaccgtggcagacctcagc
ctcatcgccagcgtctccacatttgaggcctccgatatcgatttcaagaagttcgccaat
gttaagaggtggtacgagactgtgaagacgacagcgccgggttaccaggaggccaatgag
aaggggctcgatgcgttcaaggcgctcgtcagcagcatgaagaagtaa

DBGET integrated database retrieval system