KEGG   Papilio machaon (common yellow swallowtail): 106718844Help
Entry
106718844         CDS       T05138                                 

Definition
(RefSeq) probable histone-lysine N-methyltransferase CG1716
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
pmac  Papilio machaon (common yellow swallowtail)
Pathway
pmac00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pmac00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    106718844
Enzymes [BR:pmac01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     106718844
Chromosome [BR:pmac03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     106718844
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET MIP-T3 WW
Motif
Other DBs
NCBI-GeneID: 106718844
NCBI-ProteinID: XP_014368526
LinkDB All DBs
Position
Unknown
AA seq 1586 aa AA seqDB search
MAKKRKPATQLAARRSARRGKQVNIGQVGLEGETSTTIDATTSDTQSKPPETSSAKVEET
STSIAQLSQSQNWNPTVKICPPVGLHKKFGKYRCLFNSDVTMSRKNEVCSDSETNSSIDI
KVVDLCGSSESDSNTAIEIQSDTNSSASPSPLSIVSNPQQSHSNIPLPTSSQSSEVSVVN
ELPVVSIENNVPQIPLPSDASIIENEDQPVSDKENDKEMQDKNIPSVEQIEYACDDEEII
TVVQIVEDENQELYYDIKIDSPKNEAPKETNEDEECKIYDSDFQKHFENLNLTAESRSNT
HSPMDCSELGYLQTSHCNTPDMFSKENSNDLTRPDPSLTPSSILSDESNSSRVTEQTQNN
SNDSAESSPTGVRRSNRIKTISNLKQKTKGYGLVKTPLKKALITQTKLKLEELGSDSQEK
IGESITNVTPLSSQFPIPSEMPVKVKSRWRRSSELEMGASSPAISPLASPGLPQRLLPLT
EEQTPTDVEQAAVALTKEAYDKIIEERMNQFQHLDENEYLCDRMISRDTKKMICDCFMTK
EELERGELACGEDCLNRLLMIECNSRCPVGDRCTNRRFQNKENATLKVFYADKKGCGVEA
GADIPSGEFLMEYVGEVLDYEQFYKRAQSYSDENNLHHYFMSLKGDTVIDATLKGNISRF
INHSCEPNAETQKWTVNGELRIGFFSKREIPAGEEITFDYQFQRFGKVAQRCYCGADNCR
GWIGAEPDSDDDDDEEEEEDVSTSKTGSAESEELRETDASSEQPQPRVRKPKRNRKYKPK
APDLVQDADIEEDLEALGHSGVKNQSHTLRLSRTVVRAKTRPAQTALLRLLRDADLPCRR
LFLDYRGLRLLAPWCSDASTEFRLEMLLTVDRLPITNKTMVQESRFFTIVERWRSAGVPA
PDPVFIDEATGLPVELGNRTAQDAAAQAEKNKENAAMLEKVRDLSSQLLERWSSLKEVFK
IPKKERIQQMKEHERQANVERRAADSSGSRERERERERRDERERRDDREHRERERERERE
RERERERERERERERERERDRDRDRYREREKERDRERDREDRDRRKRRSSPEARRSIRLN
ERVLAAVPPLSKEERRRAFAEAAAAAEEARRTRDPPTWPYWTQHDAFQQMFQPGMMGGAP
NMLGQMMPGLVPGMLPQEAQSEWITPSGEFQGQPAFVPSFPGAQFCMPQSNMMGFGMGGF
MFGQQIPPSFPTRPGQVPTQPTQPTMSTQSAMPTMPTQPGMTAQPTLSNIQSQRLPTLQM
QAQQNANQMSLGAQGGEKEVVLPSLWRSATDGRGRTYYYHVKLRRPQWLPPAPDPEESSS
EEEVEAMSALDTAVVRRQVKGKLVEGVNGIYEVIKEDSNNGLIPDHALVSLKPRKRRPGL
VSERPISPRTEEDKLAGRMEVKRYKQTKEKLRRRKERLLQRVRLLAAARPRKHQLKITDI
EDFETDSEDDSDDGTNEKSINLVSSPADEVEAQEEEEVETKEVVDSEEVARRIKEQFRSN
MARVMVQHLNPYRHSDAPAGRITCTADFKHLARKLTHFVMLKELKHCRSVEELIVTDSVR
TKAKTFVRKYMAKFGPVYRRPPEEAD
NT seq 4761 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaaaaggaaaccagcaacgcaactcgctgctcggcggtctgcccgccgtggg
aagcaggtcaatattgggcaggttggcttggaaggcgaaacatctaccacaatagacgcg
acaacctccgacacacaatctaaacctcccgagacatccagtgcaaaggttgaagagaca
agtacatcaattgcacaactgtctcaatctcaaaattggaatcccactgttaaaatttgc
ccacctgtagggttacataagaaatttggtaaataccgttgtttattcaacagtgatgta
actatgagtagaaaaaatgaagtatgtagtgatagtgaaactaacagtagtattgatata
aaagtagtggacctttgtggtagctcagagtctgattcaaacactgcaatagagattcaa
tcagatacaaacagttctgcaagccccagtccactgagtattgtgtcaaacccacaacaa
agtcatagcaacataccgctgccaacatcatcacaatcttctgaagtatcagtggtaaat
gagctccctgtggtaagtattgaaaacaatgtgccgcaaattcctttgccatcagatgca
tctataattgaaaatgaggaccaaccagtaagtgataaagaaaatgataaagaaatgcag
gacaaaaacattccatctgtagaacaaattgagtatgcttgtgatgatgaggaaattatt
accgtagttcaaattgtagaggacgaaaatcaagaactttattatgacattaaaatagat
agtccaaaaaatgaggctccaaaagaaacaaatgaagatgaagagtgcaaaatttatgat
tctgatttccaaaaacactttgaaaatcttaatctcaccgctgaatctaggtctaacaca
cattcacctatggattgctccgaacttggttacttgcaaacatctcattgcaatacacca
gatatgttttcaaaagaaaactctaatgatttaacaagacctgatccaagcttaacacca
agttcaatattatctgatgagagcaactcatcaagagtgacagaacaaacacaaaacaat
tctaatgattctgctgaatcatcaccaactggtgtcagacgttcaaaccgcataaagaca
attagcaatttaaaacaaaaaactaaaggatatggtttagtcaaaacaccactaaagaaa
gctttaattactcaaacgaagttaaaactagaagaattaggttcagatagtcaagaaaaa
ataggagaaagtataacaaatgttacaccactctcctcacagttccctattccttcagaa
atgcctgtcaaagtcaaatctcgttggaggaggtcaagtgagctagaaatgggtgcaagc
tcgcctgccatttcacctttagctagtccaggtctacctcaacgtttactgccattaact
gaggaacagactcctacagatgtggaacaggctgctgtggcattaactaaagaagcatat
gataaaataattgaagagagaatgaatcaattccagcatttggatgagaatgagtatttg
tgtgatcgtatgatcagtagagatacaaaaaagatgatttgtgattgttttatgaccaaa
gaagagttggaacgaggagagttggcttgcggtgaagactgtcttaatagactccttatg
attgaatgtaactccagatgtccagttggtgatcgttgtacaaatagaagattccagaat
aaggaaaatgcgactcttaaggttttttatgcagataagaaaggatgtggagtggaagct
ggtgctgatattccatcaggtgaatttctaatggaatacgtaggtgaagttttggactat
gaacagttttataagagagcacaatcatattctgatgaaaacaacctacatcactacttc
atgtcactgaaaggtgacacagttattgatgcgacattaaaaggcaacatatcaagattt
atcaatcattcatgtgaaccaaatgcggagacacagaagtggacagtcaatggagaactc
aggataggatttttcagcaaacgagaaattccagctggtgaagagatcacttttgactat
caatttcaacgtttcggcaaggtggcgcagcggtgctactgcggcgcggacaactgccgc
ggctggatcggcgcagaacccgactctgatgatgatgatgatgaagaggaggaggaagat
gtatcaacatcaaagactggttccgctgagtcagaggagttacgtgaaacagacgcgtcg
tcggagcagccacagccacgtgtgcgcaaacctaagcgtaacagaaagtacaaaccgaaa
gcccctgaccttgttcaagacgctgatatcgaggaggacctagaagcactaggtcacagc
ggtgttaagaaccagagccacacgttacgtctatcccgtactgttgtgagagcgaagacc
agacctgcacagaccgcattactccggctgttgagggatgcagacctgccttgtcgacgg
ctcttccttgattaccgtggactgagactcctggcaccatggtgttctgacgcctccact
gaattcaggctggaaatgcttctaactgtggaccgtttgccgatcaccaacaaaacaatg
gtacaagagagccgcttctttacgatcgtggagagatggcgcagcgccggcgtccctgca
ccagatcctgtcttcattgatgaagctacaggcctaccagtggaattgggaaatagaaca
gctcaggatgcagcagcacaggccgagaagaacaaagagaatgcagctatgctagaaaaa
gtcagggacctgtccagtcaattgctagaaagatggtccagtttgaaggaggtgttcaaa
attccgaaaaaggaaagaatacagcagatgaaggagcacgaacgtcaagcgaacgttgag
agaagagccgcggactcgagcggctcgcgggaacgagaacgagagcgggaacggcgcgac
gagcgagagagacgggatgatagggagcatcgtgagagagaacgggaaagggagagggaa
agagagcgagagcgcgagcgcgagagggagagggagcgagaacgcgagagagagcgggac
cgcgaccgcgacaggtacagggagcgcgagaaagagcgagacagggagcgggacagagaa
gacagagataggagaaaaagaagaagcagtccagaagcgagaagaagtatacgtttgaac
gagcgtgtcctggctgctgtgccacctctgagcaaggaggagcggaggcgcgcgttcgcg
gaggctgctgctgcggcggaggaggcgcgccgcacacgggaccctcccacatggccttac
tggacccagcacgatgccttccaacagatgttccagcctggtatgatgggtggtgcgccg
aatatgttgggtcagatgatgccgggcttggtgccagggatgctgccgcaggaggcgcag
agcgagtggatcactcccagcggggagttccagggccagcccgctttcgttccgtctttc
ccgggtgcacaattctgtatgccacagtctaacatgatgggcttcggaatgggaggcttc
atgtttgggcaacaaataccaccgtcgttccccacgaggccgggccaggtgcccacgcaa
cccacccagcctacgatgtccacgcagtcggctatgcccacgatgcccacgcagccgggt
atgacggcgcagcccacgttgtccaatatccagtcacaaagattgcccacgctacaaatg
caggcacagcagaatgctaaccagatgtctctgggagcacaaggaggtgagaaggaggtg
gtgctgccgtcactatggcgcagtgcaacagacggtcgcggccgcacatactactaccac
gtgaagttacgtcgcccgcagtggttgccgccagcgcccgaccctgaggagagttcatcc
gaggaggaggtggaagcgatgagcgcactggacacggccgtggtgcgacgtcaggtgaag
ggcaagctggtagaaggagttaacggcatttatgaagtgataaaagaggattctaacaat
ggtctgataccggatcacgctctggtatctctaaagccgaggaaacgtcggcccggtctc
gtgtctgaacgtcccattagtccacgcactgaggaggacaagttagcgggtcgtatggaa
gtgaagcggtacaagcagacgaaggagaagctgcgccggcgcaaggagcggctgctgcag
cgcgtgcgtctgctggcagcagcacgaccccgcaagcaccagctcaagatcacagacata
gaagatttcgaaactgactccgaagatgattctgatgatggtaccaacgagaagtcaatc
aacctcgtatcatcgccggcggacgaggtcgaggctcaggaggaggaggaagtggagacc
aaagaggtggtggactcggaggaggtggcgcgcaggatcaaggagcagttccgcagcaac
atggcgcgcgtcatggtgcagcatctcaacccgtaccgacattcggatgctcccgctggc
aggatcacgtgtacggcagacttcaaacatctcgctagaaagttgacacatttcgtgatg
ctaaaagagttaaagcactgtcggtcagtggaagagctgatagtgactgactcggtgcgg
accaaagctaaaacgtttgtgcgcaagtacatggccaagtttggtccggtgtaccgtcgt
ccacctgaggaggctgactag

DBGET integrated database retrieval system