KEGG   Papilio machaon (common yellow swallowtail): 106720353Help
Entry
106720353         CDS       T05138                                 

Definition
(RefSeq) serine protease 53-like
  KO
K09640  
transmembrane protease serine 9 [EC:3.4.21.-]
Organism
pmac  Papilio machaon (common yellow swallowtail)
Brite
Enzymes [BR:pmac01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     106720353
Peptidases [BR:pmac01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   106720353
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 524 aa AA seqDB search
MYSLLFVLTIIGLATSLPTKSKEDIRIVGGEDIDITLAPYQVSLLRRGRHTCGGAIIAND
LIVTAAHCVTGSNARDYSVRVGSSSSQSGGQVIPVSDLAWHRNFTYSKMDCDVALVRLSV
PLVFSDSIAPIDMLQINEEIPDGDITMVTGWGNLRETGGYPRQLQMVLVPTVNTAMCDVA
YSPSYTVTSTMICAGVPEGGKDACQGDSGGPLVHNGRLAGIVSWGLGCARPNYPGVYAKV
AALRDWIDQNSEILRQKYVLRAFSSVPTIKAKEDVRIVGGEDIDITSAPYQISLVKRGRH
TCGGSIIAFDTILTAAHCVLNTTPQDYLVRVGSSSYEKGGELYPVNDLLWHPNFTYTKMD
SDVALLFLSKPITFNDGIAAIELINHDEEIKDGEITMVSGWGNLRENGGYPTKLQMVLVP
KVNSDECNKAYSPMYNITSTMLCAGVPEGGKDACQGDSGGPMVHNGRLVGVVSWGLGCAR
PNFPGVYAKVSALRGWIDQSITYLRRKHIFRPFPFLVLDKLFKL
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgtatagtctactatttgttttaaccatcattggtctagcgacatcgctacccacaaaa
tcaaaggaagatattagaatagttggtggagaagatattgatataactctagctccgtat
caagtgtcgttattaagaagaggtcgtcatacatgcggtggagccattattgcgaatgac
ctcattgttacagccgcccattgtgttactggttcaaacgctcgcgactattcagttcgt
gttggttcatcgtcaagtcaatcaggtggtcaagtgataccagtcagtgatctagcatgg
catcgcaacttcacgtattccaagatggattgtgatgttgctttagtgagactgtcagta
ccattggtatttagcgacagtattgcacctattgacatgctacaaattaatgaagagata
cctgacggagatattactatggttactggatggggaaaccttcgggaaactggtggatat
cccagacagctacaaatggtgttagtaccgacagtaaataccgccatgtgtgacgtagcg
tattcaccgtcctacactgtcacatctacgatgatctgcgctggtgtgccagaaggcggc
aaggatgcttgtcagggtgacagtggtggtccattggtgcacaatggtcgtcttgcagga
atcgtatcctggggtttgggctgcgctcgaccaaactatcccggagtttatgcaaaagtt
gcggcattgagagactggatcgaccaaaacagtgaaatattgcgccagaaatatgtttta
agagcgttttcgtcagtaccgacaatcaaagcaaaagaagatgtgaggattgttggtgga
gaagatatagatataacatcagctccgtatcaaatatcactagtaaaaagaggtagacat
acctgtggtggatctattattgcttttgatacaatattaacagcagcacattgcgtttta
aataccacaccccaagattatttggtccgtgttggctcatcttcgtacgaaaaaggtgga
gaactttatccagttaatgatttactctggcatccgaatttcacttataccaaaatggac
agtgatgtagcattactctttctttccaaaccaataacatttaatgacggcatcgctgct
atcgagttgataaatcacgacgaagaaattaaagacggtgaaattacaatggtatctgga
tggggaaatttgcgcgaaaatggtggctacccaactaaactacaaatggtgcttgtaccc
aaagtgaattcagatgaatgcaacaaagcttattcgccgatgtataacataacatccacg
atgttgtgcgctggagttcccgaaggtggcaaagatgcgtgtcagggtgacagcggtggt
ccaatggtccacaatggaagattagttggcgttgtatcgtggggcttgggctgcgctcgg
ccgaacttcccgggtgtctacgccaaggtgtctgcactcagaggctggatcgatcaaagc
atcacatatttacgtcgtaaacatatatttagaccgtttccatttcttgtattagataag
ctatttaaattatag

DBGET integrated database retrieval system