KEGG   Prauserella marina: BAY61_01235Help
Entry
BAY61_01235       CDS       T04988                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
pmad  Prauserella marina
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(318873..319793)
Genome map
AA seq 306 aa AA seqDB search
MLATLTDQYFSDPDWIFERKLDGVRALCVREAGEEPHLWSRNHRSADASYPELVTALAEQ
GGESFVADGEIVAFDGDQTSFAKLQPRIHVNDPAKAKATGIPVVYYLFDLLEYDGQDATR
LPLRRRKELLRQAFDFHDPLRLSMHRVGAGERFLQQACERGWEGLIAKRADARYTSGRSR
DWLKFKCVSDQEFVVGGFTDPSGARAGFGALLIGYYSGSDLRYAGKVGTGYGDATLRDLR
GRLDDLAVEESPFVDQVREPRAHWVRPEMVVQVRFSEWTGDGRLRHPRFTGLRNDKAAHE
VVREVP
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgctggcaacgctcaccgaccagtatttctccgaccccgactggatcttcgagcgcaag
ctcgacggggtcagagcattgtgcgtgcgcgaggcaggcgaagaaccacacctgtggtcg
cgcaatcaccgcagcgccgacgcgagctaccccgagctggtgaccgcgctcgcggagcag
ggaggggaaagcttcgtggccgacggcgagatcgtcgcgttcgacggcgaccagacgagc
ttcgccaaactccagccgcgcatccacgtcaacgatcccgcgaaggcgaaggcgaccggg
attcccgttgtctactaccttttcgacctgcttgagtacgacggccaggacgcgacccgg
cttccgctgcgccggcgcaaggaactgctgcggcaggctttcgacttccacgacccgctc
cggctctcgatgcacagggtcggcgctggcgagcggtttctgcagcaggcgtgcgaacgc
ggctgggaagggctcatcgcgaagcgggccgacgcgcgctacacgagtggccgctcgcgt
gactggctgaagttcaagtgcgtcagcgatcaggagttcgtcgtcggcgggttcaccgac
ccctccggcgcgcgagcgggcttcggcgcgctgctgatcggctactactccggctccgat
ctccgctacgcgggcaaggtcggcaccggttacggcgacgcgacgttgcgcgaccttcgc
ggcaggctcgacgacctcgccgtcgaggaatcaccgttcgtcgaccaggtcagggaaccg
agagcgcattgggttcgcccggaaatggtggtgcaggtccggttcagcgagtggaccgga
gacgggcgactgcggcaccctcgattcaccggcctgcgcaacgacaaggcggcacacgag
gtggtgcgggaggtgccatga

DBGET integrated database retrieval system