KEGG   Prauserella marina: BAY61_14890Help
Entry
BAY61_14890       CDS       T04988                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
pmad  Prauserella marina
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ASR36076
UniProt: A0A222VQ61
LinkDB All DBs
Position
complement(3194234..3195241)
Genome map
AA seq 335 aa AA seqDB search
MASRKEPSPSVTLDVGGYPVRLSNPQRVYFPARGETKLDLANYYLGVGDGIVRALRERPC
MLHRFPSGVSGEKVHQKRVPHGAPPWLDTVRVHFPRYGRHADELCVTKLADVIWAVQMST
VEFHPWNSRRADTEVPDEWRIDLDPMPECGFDRVRRVAHVAHEVLDELGAVGWPKTSGGR
GLHIYVRISPEYGFTDVRRAALAFAREVERRAPHDVTTAWWRKDRDPAMLFVDYNQNARD
HTIASAYSVRGNADGTVSAPVTWAEIDDIDPGDFTIATVPARFAEIGDPHAGIDDAVFSL
TGLLEWADRDERDGARDPGGDSAGSGNPVEPIDLD
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgcggaaagagcccagcccctcggtgacactggatgtcggcggctatccggtg
cggttgtccaatccgcagcgggtgtacttccccgctcgtggggagaccaagctcgacctc
gccaactactacctcggcgtcggggacgggatcgtgagggccctgcgcgagcgcccctgc
atgctgcaccgctttccctcaggggtcagcggggagaaagttcaccagaagcgcgtaccg
cacggcgcgccaccatggctggacacggtgcgcgtgcacttcccccgctatggacggcac
gccgacgaactgtgcgtcaccaagctcgccgacgtgatctgggccgtccagatgtccaca
gtggagtttcatccgtggaactcgcggcgcgccgacaccgaggttcccgacgaatggcgc
atcgatctcgacccgatgcccgagtgcgggttcgaccgggtgcggcgcgtcgcccacgtc
gcacacgaggtgctcgatgaactcggtgccgtcggctggccgaaaacctcgggaggacgc
ggcctgcacatctacgtcaggatcagtcccgagtacggcttcaccgacgtgagaagggcg
gcgctggccttcgcgagggaggtcgagcgcagggcaccgcacgacgtgacgacggcgtgg
tggcgcaaggacagggacccggccatgctgtttgtcgactacaaccagaacgcccgcgac
cacacgatcgccagcgcgtattcggtgaggggcaacgcggatggcaccgtgtcggccccg
gtgacctgggccgagatcgacgacatcgaccccggcgatttcaccatcgcgacggtcccc
gcccgcttcgccgagatcggcgatccgcacgcgggcatcgacgacgccgtgttctcgctg
acgggcctgctggagtgggccgatcgcgacgaacgcgacggcgctcgcgacccaggtggc
gattcggctggttccggaaacccggtggaaccgatcgatttggactga

DBGET integrated database retrieval system