KEGG   Prauserella marina: BAY61_25740Help
Entry
BAY61_25740       CDS       T04988                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
pmad  Prauserella marina
Pathway
pmad00250  Alanine, aspartate and glutamate metabolism
pmad00410  beta-Alanine metabolism
pmad00640  Propanoate metabolism
pmad00650  Butanoate metabolism
pmad01100  Metabolic pathways
pmad01120  Microbial metabolism in diverse environments
Module
pmad_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pmad00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BAY61_25740
   00650 Butanoate metabolism
    BAY61_25740
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BAY61_25740
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BAY61_25740
Enzymes [BR:pmad01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BAY61_25740
Amino acid related enzymes [BR:pmad01007]
 Aminotransferase (transaminase)
  Class III
   BAY61_25740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ASR37840
UniProt: A0A222VVC2
LinkDB All DBs
Position
5612297..5613550
Genome map
AA seq 417 aa AA seqDB search
MAQLSPILKQATPVVVDHGEGVYLFDADGRRYLDFTAGIGVTSTGHCHPRVVAAAQEQVG
KLIHGQYTTVMHKPLLDLTAKLGEVLPPGLDSLFFSNSGSEAAEAALRLSRQATGRPNIV
VFEGGFHGRTVAAASMTTSGTRFSAGFSPLMGGVHVAPFPFAYRYGWDEKTATEFALREL
DYLFATRTSPSETAAFFIEPMLGEGGYVPANTEFLAGLRERADEHGILLVLDEIQTGFGR
TGKFWGHDHFDVRPDVVLIAKGLASGFPLSGIAASKELMAKAWPGSQGGTYGGNAVSCAA
AAATLDVIRDEGLVENAAARGRQLLDHARAIGDKTEAIGDVRGLGLLIGTEFTTAEGKPD
TATAQAAQKAAAERGLLLLTCGAHMNVVRMIPPLIVTEEQIEEAREIWADVVQTVAK
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcccagctctcccccatcctcaagcaggccacgccggtcgtcgtcgaccacggcgag
ggcgtctatctttttgacgccgacggcaggcgctacctcgacttcacagccggtatcggc
gtgacgagcaccggacattgccaccctcgggtcgttgccgcggcccaggaacaggtcggc
aagctcatccacggccagtacaccaccgtgatgcacaagccgctgctcgacttgacggcc
aagctcggcgaggtgcttcctccgggactcgactcgctgttcttctccaactcgggcagc
gaggccgccgaggccgcgctgcggctgagcaggcaggccaccggaaggccgaacatcgtc
gtgttcgagggcggcttccacggccgtaccgtcgccgccgcgtcgatgacgacgtcgggc
acccggttcagcgcgggcttctccccgctcatgggcggcgtgcacgtcgcaccgttcccg
ttcgcctaccgctatggctgggacgagaagaccgcgaccgagttcgcgttgcgcgagctc
gactacctcttcgcgacgcggacctcgccttcggagacggcggccttcttcatcgagccg
atgctcggtgaaggcggctacgtgcctgcgaacacggaattcctcgcggggctgagggaa
cgcgccgacgaacacggcatcctgctcgtgctcgacgagatccaaaccggcttcggccgt
accggcaagttctggggacacgatcacttcgacgtccggcccgacgtggtgctcatcgcg
aagggactcgcctccggcttcccgctttccggcatcgcggcttcgaaggagctgatggcc
aaggcgtggccgggctcgcagggcggaacctacggcggcaacgcggtttcctgcgccgcc
gcggcggcgaccctcgacgtcatcagggacgagggccttgtcgagaacgcggccgcgcgg
ggaaggcaactgctcgaccacgcgagggcgatcggcgacaagaccgaggcgatcggcgac
gtgcgcggtctcggtctgctgatcggcaccgagttcaccacggcagagggcaagccggac
acggcgacggcgcaggcggcccagaaggccgcggccgagcgcgggctgctgctgctcacc
tgtggcgcccacatgaacgtcgtgcgcatgatcccgccgctcatcgtcaccgaggagcag
atcgaggaggctcgcgagatctgggccgacgtcgtccagaccgtcgcgaagtag

DBGET integrated database retrieval system