KEGG   Parus major (Great Tit): 107204624Help
Entry
107204624         CDS       T04864                                 

Gene name
SUV39H2
Definition
(RefSeq) histone-lysine N-methyltransferase SUV39H2 isoform X1
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    107204624 (SUV39H2)
Enzymes [BR:pmaj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107204624 (SUV39H2)
Chromosome and associated proteins [BR:pmaj03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107204624 (SUV39H2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    107204624 (SUV39H2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo
Motif
Other DBs
NCBI-GeneID: 107204624
NCBI-ProteinID: XP_015483577
LinkDB All DBs
Position
1A
AA seq 434 aa AA seqDB search
MEGWRGAWYVPCLASLETLQELCRKENLTCKSIGITNRSLKSYEVEYLCDYKVEEGKAYY
LVKWKGWPESSNTWEPQKHLNCPLLIQNFLRDKNEYLSRGREGKAMKVRNHVKTLKPAIA
DYIVKKAKQRIALQRWKEELNRKKNHKAMILVENTVDLEGPPVDFYYINEYKPAPGINVL
NGITTGCECADCPAEKCCPKEAGFILAYNKRKKLKIQPGLPIYECNSYCRCGPDCPNRIV
QKGTPYSLCIFRTNNGRGWGVKTLQRIKTNSFVMEYVGEVETRYCCASAVDKLHPEKPQS
IIISSAVITSEEAEKRGQLYDNQGNTYLFDLDYDSDEFTVDAARYGNVSHFVNHSCDPNL
QVFNVFIDNLDLRLPRIALFSTRTIKAGEELTFDYQMKGSIDLTSDSAEGLSPSKKRIRT
VCKCGAVCCRGYLN
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggagggctggcgaggagcctggtatgtgccatgtctagcttcacttgagaccctccaa
gaattatgtaggaaggaaaatctcacatgtaaatccattggaatcaccaacaggagtcta
aagagttatgaggtggaatatttgtgtgactacaaggtagaagagggcaaagcatactat
cttgtgaaatggaaaggatggccagaatcttcaaatacttgggaacctcagaaacatctg
aactgccctctgcttattcagaactttcttagagacaagaacgaatacttgtctcggggg
agagaaggcaaagcaatgaaagtgagaaaccatgttaaaactttgaaacctgcaattgca
gattatattgtaaagaaggctaaacaaagaatagctctgcagaggtggaaagaagaactc
aacaggaagaagaatcacaaagcaatgattctggtagaaaacaccgtggatcttgaaggc
cctcctgtagacttctactatatcaatgaatataaacctgctccaggaataaatgtgctc
aatggaataacaactggctgtgaatgtgctgactgccctgctgagaagtgctgtccaaaa
gaggctgggtttattttagcttacaataaacgtaagaaattgaaaatccagcctggcttg
cccatctatgaatgcaattcatattgtaggtgtgggcctgactgcccgaataggattgta
cagaaagggaccccgtattccctctgcatcttcagaaccaacaatggccgtggctgggga
gtaaaaaccctccagagaattaaaaccaacagttttgtgatggagtatgttggagaggtg
gagacaaggtactgctgtgcatcagctgtagacaaattgcatccagagaagcctcagtca
ataataattagttcagctgtgattacaagtgaggaagcagagaagcgaggccagctctat
gacaaccagggaaatacatacttgtttgatttggactatgactcagatgaatttacagta
gatgcagctcgatacggaaatgtgtcccactttgtgaaccacagttgtgatccaaatctt
caagtcttcaacgtgtttattgataacctcgacttgcgtcttcctcgaatagcgctgttc
tctacccgaaccatcaaggctggagaagagctcacctttgactatcagatgaaaggttca
atagatctgacttcagactctgctgaaggtcttagcccatccaaaaagaggatcagaact
gtctgtaaatgtggagctgtgtgttgcagaggttatctcaattga

DBGET integrated database retrieval system