KEGG   Parus major (Great Tit): 107205142Help
Entry
107205142         CDS       T04864                                 

Gene name
B3GALT5
Definition
(RefSeq) beta-1,3-galactosyltransferase 5
  KO
K03877  
beta-1,3-galactosyltransferase 5 [EC:2.4.1.-]
Organism
pmaj  Parus major (Great Tit)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Glycosphingolipid biosynthesis - globo and isoglobo series
Metabolic pathways
Module
Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    107205142 (B3GALT5)
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    107205142 (B3GALT5)
Enzymes [BR:pmaj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     107205142 (B3GALT5)
Glycosyltransferases [BR:pmaj01003]
 Glycan extension
  Type 1 chain
   107205142 (B3GALT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
1
AA seq 344 aa AA seqDB search
MKMRGTWLGVPIGHLLALGHRNKWRNMVDSRKFRVFVCLLGLSSASLWALYSWMELCVLC
ESSQGYIFPTGTFRRVEGNFSQLPDIDCHKNPPFLVLLVASSFQQVDARMAIRHTWGKER
TVAGKRLVTFFLLGSPVDPSQQADIAAESQRYRDIIQKNFTDTYYNLTLKTMMGIEWIHR
FCSQSSFAMKTDTDVFVNVFYLTELLLRKKKTAGFFTGFLKLHEYPIRTRGSKWHVSREE
YPGTTYPPFCSGTGYVLSSDVASQIYNISESVPFIKLEDVFIGLCLDKLKIGLEELHSEQ
TFFPERIRFSVPRFKKIVTCHGIKPSEQLSYWNHLVAGAPGGVL
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgagaggaacctggctgggtgtgcccattggacacctgctggctctgggacac
aggaacaaatggagaaatatggtggattccagaaagttcagggtgtttgtctgcctgctg
gggctcagcagtgccagcctctgggctctctacagctggatggagctctgcgtgctgtgt
gagagcagccagggttacatcttccccacggggactttcaggagggtggaagggaacttc
tcacagctcccagacatcgactgccacaagaaccctcctttcctcgtcctgctcgtggcc
tcctcgttccagcaggtggatgccaggatggccatccggcacacctggggcaaggagagg
acagtggctggcaagcgcctggtgacgtttttcctcctggggagccccgtggatcccagc
cagcaggctgacatcgctgctgagagccagaggtacagagacatcatccagaagaacttt
acagacacctattacaacctgaccctgaagaccatgatggggatcgagtggattcacagg
ttttgttcccagtccagctttgccatgaaaactgacaccgacgtgtttgtcaacgttttt
tacctcactgagctgctcctgaggaaaaagaagactgctggattcttcacaggcttttta
aaactgcacgagtaccccatcaggacaagagggagtaaatggcatgtgagtagggaagag
tacccaggaacgacctatccacccttttgttctgggactggatatgttttatccagtgat
gtagccagccagatctacaacatttctgagagtgttccattcattaaactggaggatgtg
ttcataggactgtgccttgacaaattaaaaattgggctggaggagcttcactcggagcag
acgtttttcccagaaaggatcaggttctctgttcctcgctttaagaaaatcgtgacgtgc
catggaataaaaccctctgagcagctgagctactggaaccacttggtggcaggagctcca
ggaggagtgctctag

DBGET integrated database retrieval system