KEGG   Parus major (Great Tit): 107208201Help
Entry
107208201         CDS       T04864                                 

Definition
(RefSeq) pancreatic alpha-amylase-like
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
pmaj  Parus major (Great Tit)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    107208201
Enzymes [BR:pmaj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     107208201
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
8
AA seq 512 aa AA seqDB search
MGIYFLLLTAGLCWGQYNPNTLPKRTSIVHLFEWRWQDIAQECERYLAPNGFGGVQISPP
NENVIITDPQQPWWERYQPVSYKLCTRSGNETEFRDMVTRCNNVGVHIYVDAVINHMCGA
NAGAGDHATCGSDFNAKTEDFPAVPYSAWDFNDHKCKSRSGNIENYHDISQVRDCRLLSL
LDLALGKDYVRSRIAEYLNHLIAIGVAGFRIDAAKHMWPADVKAILDKLKDLNTQWFPAG
TKPFVYQEVIDLGGEPIQSSEYFGNGRVTEFKYGAKLGTVIRKWNGEKMAYLKNWGEGWG
FMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMASGFMLAHPYGFTRVMSSFRWP
RYFENGKDINDWVGPPSNADGSTKPVTINEDTTCGNDWVCEHRWRQIRNMVIFRNVVDGE
PFSNWWDNGSNQVAFGRGNKGFIIFNNDDWSLNVSLQTGLPAGTYCDVISGQKEGDFCTA
VEVRVAADGKANFLIGNEDEDPFIAIHVDAKL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggggatctattttctgctgttaactgcagggctctgctgggggcagtacaaccccaac
actctcccaaagagaacatctattgtgcatctctttgaatggcgctggcaggatattgct
caggagtgtgaacgctacttagctcctaatggatttggaggtgttcagatttcacctcca
aatgaaaatgttatcattactgacccccagcaaccatggtgggaaagataccagcctgtc
agctacaagctgtgcacaagatctggaaatgaaactgaatttagagacatggtgaccagg
tgcaacaatgttggagtgcacatttatgtggatgcagtaatcaaccatatgtgtggagct
aatgctggggctggtgaccacgctacttgtggaagcgatttcaatgcaaagaccgaagac
ttcccagctgtgccctattctgcctgggactttaatgatcataaatgtaaatctagaagt
ggaaacattgagaattatcatgatatatctcaggtgcgggactgccgcctgctcagcctg
ctggacctggccctggggaaggactacgtgcgctccaggattgccgagtacctgaaccat
ctcattgccatcggcgtagcagggttccggatcgacgctgccaagcacatgtggcctgcg
gatgtcaaggcgattttagacaagctgaaagatctaaatactcaatggtttcctgcagga
actaaaccttttgtttaccaggaggtaattgacttgggtggagagcccatccaaagcagc
gaatactttggaaatggccgagtgacagaattcaaatacggtgccaagctggggacagtg
atccgcaagtggaacggagaaaagatggcctacctaaagaactggggagaaggctggggc
tttatgccttccgacagagccctggtctttgtggataaccacgacaaccagagaggacac
ggggctggtggagcttctattctcaccttctgggatgccaggctctataaaatggcgtct
ggtttcatgcttgcccacccgtacgggttcacacgtgtgatgtcaagtttccgctggcca
agatattttgaaaatggaaaggatatcaacgactgggttgggcccccaagtaacgcggat
ggctccacaaagcctgttacaatcaacgaggacacgacctgcggcaacgactgggtttgt
gaacatcgctggcgtcagatcaggaacatggttatcttccgtaacgtggtggatggtgag
cctttctccaactggtgggacaatggcagcaatcaagtggcttttggccgtggtaataaa
ggcttcatcatcttcaataatgatgactggtcattgaatgtatctctgcagactggtctg
cctgctggcacttactgtgatgtcatatctgggcaaaaggaaggtgacttctgtacagca
gttgaagttcgtgttgctgctgatggcaaggctaatttcctgattgggaatgaagatgaa
gacccattcattgccattcatgttgatgctaaattgtaa

DBGET integrated database retrieval system