KEGG   Parus major (Great Tit): 107208209Help
Entry
107208209         CDS       T04864                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  
prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
pmaj  Parus major (Great Tit)
Pathway
Arachidonic acid metabolism
Metabolic pathways
VEGF signaling pathway
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    107208209 (PTGS2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    107208209 (PTGS2)
Enzymes [BR:pmaj01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     107208209 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
8
AA seq 706 aa AA seqDB search
MNEINSKSSISGAPRWQELAVARRQPRAVPSAGDRPSLTPASSGARPGRAGAGRGGKRNS
PLGSCFRPVTQLGSARYCHKYGMCSRGRHLELPSQPRQPSPAMPLLPLALLAALLAAGRA
ANPCCSNPCQNRGVCMSAGPDRYECDCTRTGYYGQNCTTPEFFTWLRLALKPSPNTVHYI
LTHYQGAWNIINNIPFLRDTIMRYVLTSRSHLIDSPPTYNSDYSYKSWEAYSNLSYYTRS
LPPVGLDCPTPMGVKGKKELPDSNLIVEKFLLRRKFIPDPQGTNVMFTFFAQHFTHQFFK
TDHKRGPAFTRALGHGVDLNHIYGETLERQLKLRLRKDGKLKYQMINGEMYPPTVRDTQA
EMLYPPHVPEHLQFSVGQEVFGLVPGLMMYATIWLREHNRVCDVLKHQHPDWDDEQLFQT
TRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQRFQYQNRIAAEFNTLYHWHPLL
PDTFQIHDQEYTFQQFLYNNSIMLEHGLSHMVKSFSKQSAGRVAGGKNVPAAVQKVAKAS
IDQSRQMRYQSLNEYRKRFMLKPFRSFEELTGEKEMAAELEELYGDIDAMELYPGLLVEK
PRPGAIFGETMVEMGAPFSLKGLMGNAICSPEYWKPSTFGGKVGFDIVNTASLQKLICNN
VKGCPFTAFHILPPEPTEATINVSTSKTAMEDINPTLLLKERSAEL
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaataaatagcaagtcgtcaatcagcggagccccgcgctggcaggagctcgct
gtggcacggcgccagccccgtgccgtcccctcagccggtgacaggccgtccctcacacct
gcctcgagcggggccaggccggggcgggccggggcgggccggggcgggaagagaaattcc
ccgctgggttcgtgcttccggccagtgactcagctgggctccgctcggtactgccataaa
tacgggatgtgcagcaggggacgacacttggagctgccgagccagccccgccagcccagc
cccgccatgccgctgctgcccctggccctgctggccgcgctcctggccgccggccgcgcc
gccaacccttgctgctcgaacccctgccagaacagaggtgtctgcatgagtgctgggcca
gatcgctacgagtgcgactgcaccaggacaggctactacgggcagaactgcaccacaccg
gaattcttcacgtggctgaggctagcactgaaaccatcaccaaacactgtccactacatc
ctcacccactaccaaggagcctggaatatcatcaacaacattcccttcctacgggacact
attatgagatatgtactaacttcaagatcacacttgattgacagcccaccaacttacaat
agtgactacagttacaaaagctgggaagcttattccaatctttcctactacacgagaagc
cttccaccagtaggacttgactgcccaacaccaatgggtgttaaaggcaagaaagagctc
ccagattcaaatctgattgtggagaagtttttgctgaggagaaagtttattcctgacccg
caaggcacaaatgtgatgttcacgttctttgcccagcacttcacccaccagttcttcaag
acggaccacaagcggggccctgccttcaccagagcgctcggccacggggttgacttgaac
cacatttatggagagactctggagagacaacttaaactgaggcttcgaaaggatggaaag
ctaaaataccagatgatcaatggagaaatgtacccgccgacggtgcgggacacacaggca
gagatgctgtacccaccccatgtgcctgagcacctgcagttctctgtggggcaggaggtg
ttcgggctggtgccagggctgatgatgtatgccacgatctggctgcgcgagcacaaccgc
gtctgtgacgtgctcaagcaccagcaccccgactgggacgatgagcagctcttccagacc
acccgtctcatactgataggagagacaatcaagatcgttatagaggactatgtgcagcac
ctgagcgggtaccacttcaagctgaagtttgaccccgagctgctgttcaaccagaggttc
cagtaccagaaccgcattgcagccgaattcaacaccctgtaccactggcacccactgctg
cctgacaccttccagatccatgaccaggagtacaccttccagcagttcctgtacaacaac
tccatcatgctggagcatggactctcccatatggtcaaatctttctccaagcaaagtgct
ggcagggttgctggtgggaagaatgttcctgctgcggtacagaaagtggcaaaggcctcc
attgaccaaagcagacagatgaggtaccagtccttgaacgagtacaggaaacgcttcatg
ctgaaaccattccgatccttcgaagagcttacaggagaaaaagagatggcagcggagctg
gaggagctctacggggacattgatgccatggagctgtacccaggcctgctggtggagaag
ccccggcccggggccatctttggcgagaccatggtggaaatgggggcaccattctccctg
aaggggctgatgggcaatgccatctgctcccctgagtactggaagcccagcaccttcggg
ggcaaggtgggctttgacatcgtcaacacagcctccctgcagaagctcatctgcaacaac
gtgaaaggctgtcccttcactgccttccacatcctgcctcctgagcccaccgaggccacg
attaatgttagtacctcaaaaactgccatggaagatatcaaccccacgcttctgctgaaa
gagcgctctgccgagctgtag

DBGET integrated database retrieval system