KEGG   Parus major (Great Tit): 107211503Help
Entry
107211503         CDS       T04864                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETDB2
  KO
K18494  
histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
pmaj  Parus major (Great Tit)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    107211503
Enzymes [BR:pmaj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107211503
Chromosome [BR:pmaj03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107211503
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    107211503
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
1
AA seq 1082 aa AA seqDB search
MEEKRMLCDFFEEENLTSPREESTEGDVKTFWTQLGGRRVDVIFEQVQNVLSVLKEKIKN
GTATNQECWQAWALVNEANLGDLLTLANVSDELNGDGTQETKPNLQPLLPDVNAADTVEA
SDSEKEDMERTCSESKEASSKIQGLSLNVQYQNHKCSSACLANRAAGSYKGENPLKIPIL
FDFQRRHAKADCLSKPLDVNYKAPCGRSLRSFQDVQNYLFETECNFLFVDHFSFNTYVLL
GRNTMNPEPLVFEFDISNGAESVPVSFCNSLDHARLPYFKYRKSSWPRGYYLNNFSSLFV
DSCDCTDGCIDRSKCACLQLTARGCSKIPLSPSSKRSRGYRYKRLEGPVPSGIYECSVLC
RCDKLMCQNRVVQHGIQVRLQVFNTEKKGWGVRCLDDIDKGTFVCTYSGRLMSRAEVLGD
AEQELKEKSAVNDRGHDFSSRKRKLDIDCSDSVVELVQTDKNDILENQESLSQTVDNENK
SSLVHLKNSSNAAVGGPGTKTLVFHNHQLKMVHSVSSDEDDCSQIHQSSKTKLMSGTKKG
KEKSTQKQKEEHLMEVGQTDSAGVQSAGCKRKSLSLQSVHCRKSRVPDDTCIVRPSNNTP
LKADCKGNSRQPKQDALCEESDGDGMLPKNDNEGNIYVLDATKEGNVGRFLNHSCCPNLF
AQSVFVETHNRSFPWVAFFTNRHVKAGTELTWDYGYEAGSMPETEISCHCGVQKCRKKTL
RARLPAGRAGAAANQRRAGGRGGEPADATAHAPCSGRARSLPRGTVEVGGGGGGSHGWLG
PGRAESPRSPAPGAFWIMAKMVRRRCAFCSEGEAGSVMYIATERDIAAHQDCLLFSSGFV
ESEDQNPENLEIRFDVSSVLKELRRGKRLVCNFCRKKGATVGCEERTCRRSYHFFCALCD
DAAVETDQVNGIYRVFCPKHDPGNRTNHYDAANKKRRRTLTPPTITEEMSTEETAEENHL
RILKRKNNRHKVRIDFVRKCKQAGLLDDIFEEMLDTLHLAQEKLMDDNTSETEYEETVMA
LFDCGLFENILTNIHSGTEEKIQKLLENRKRLDHKIELLQDVKEVILPTPENTASTSSTM
SE
NT seq 3249 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaaaagaatgctgtgtgacttctttgaagaggagaaccttaccagtcccagg
gaggagagcactgaaggtgatgtgaagacattttggacacagctgggaggtagaagagta
gatgtcatatttgagcaagtgcaaaatgtgctgtcagtgctgaaggaaaagatcaagaat
ggaactgcaacaaaccaagaatgctggcaggcttgggcactggtgaatgaggccaatcta
ggtgatctcttaaccttggcaaatgtaagcgatgagttgaatggagatggtacacaggaa
accaaaccgaacctgcagcctcttcttccagatgtcaatgctgcagacactgtagaagct
tctgacagcgaaaaagaagacatggaaagaacctgctcagagagtaaagaagcatctagc
aaaattcaaggtttatctttaaatgtgcaatatcagaaccacaagtgctctagtgcatgt
cttgccaacagagcagcgggctcctacaagggtgaaaatcctctgaagatcccaatcctg
tttgactttcaaagacgccatgcaaaagcagattgcctttcgaagcccctggatgtgaat
tacaaagctccttgcggtcggagtctgagaagctttcaagatgtacaaaattacttgttt
gaaacagagtgcaatttcttatttgttgatcacttctccttcaacacatatgtgctgttg
ggcaggaacaccatgaatcccgagcccctcgtgtttgagttcgatattagcaacggagca
gagtctgtgcctgtctccttctgtaacagtcttgaccatgcaagattgccttatttcaag
tatcggaagtcatcgtggccacgtggatattatctcaacaatttctccagcctgtttgtt
gattcctgtgactgcacagatggctgcattgataggtccaaatgtgcatgcctacagcta
acagcaaggggctgtagtaaaattcctctgtcaccaagtagtaaaagatcccgtggatac
cgttacaaaagactggagggacctgttcctagtgggatttacgagtgtagcgtactgtgc
aggtgtgacaagctgatgtgtcagaacagagttgtacagcatggcattcaagtcaggctg
caagtgttcaacacggagaagaagggctggggtgtccgctgcctggacgacatcgacaag
gggacatttgtttgtacttactcaggcagattaatgagcagagctgaagtgttgggagat
gctgagcaagagctgaaggagaaaagtgcagtgaatgacagaggccatgacttttcttcc
agaaaaagaaaacttgacattgattgttcagactcagtggttgaactagtgcagactgac
aaaaatgacattctcgagaatcaggaatctttgtctcagactgtggataatgaaaataaa
tcaagcctggttcatctaaagaactcaagtaatgcagctgtgggaggtcctggaacaaaa
acacttgtttttcacaatcaccagctaaaaatggtgcacagtgtcagctcagatgaagat
gattgttctcagattcatcagtcaagcaaaacaaaactaatgagtggaacgaagaaagga
aaagaaaaatccacccagaagcagaaggaagaacatctgatggaagttgggcagactgac
tctgctggtgtacagagtgcaggatgcaaaagaaagagtctgtcactgcagagtgttcat
tgtcgcaagtccagagtgcctgatgacacatgtattgtgagaccatccaataatacaccc
ctaaaagctgactgcaaaggaaatagcaggcagccaaaacaagatgcactttgtgaggag
tctgacggtgatgggatgcttcccaagaatgataatgaaggaaatatttatgtattggat
gccacaaaagaaggaaatgtgggtcgttttctaaatcacagctgctgcccaaatctcttt
gcacaaagtgtgtttgtagaaactcacaacagaagttttccatgggtggcattcttcaca
aacagacatgtgaaagctggaacagaactcacatgggattatggttatgaagctggaagc
atgccagagacagagatttcctgtcactgtggagttcagaagtgcaggaaaaaaacctta
cgggcacgccttcccgccggccgcgcgggggcagcagccaatcagcgccgcgcgggcggg
cggggcggagagccggcggacgccaccgcgcatgctccgtgctccggccgggcacgctca
cttccgcgcgggacagttgaggttgggggagggggcggtgggagtcacggctggctcggg
ccgggccgcgccgagagcccgcgttctcctgctccaggtgctttctggataatggcgaag
atggtgagaagaagatgtgcattttgttcagaaggggaggctggctctgtgatgtatatc
gccacagagagagatattgcagctcatcaggattgtctgttattttcctcaggatttgtg
gaatctgaagatcagaacccagaaaatctggaaataaggtttgatgtgtcatcggtgtta
aaagagctcaggagaggaaagcggctggtgtgcaacttctgccgcaagaagggggccacg
gtgggctgtgaggagcgcacgtgccgcaggagctaccacttcttctgcgcgctctgcgat
gacgcagccgtggagaccgaccaggtcaacggcatctaccgagtgttctgcccaaaacat
gacccagggaataggaccaatcactatgatgcagcaaataagaaaagaagacgtacattg
acacctcccaccatcacagaagaaatgagtacagaagagacagcagaagaaaaccattta
cgaatactaaaacgaaagaacaacaggcataaagttcgaatagactttgttaggaaatgc
aaacaagctgggcttctggatgacatatttgaagaaatgctggacacacttcacctggct
caggaaaaactgatggatgacaacacttcagaaacagagtatgaagagacagtgatggca
ctgtttgactgtggactgtttgaaaatatactgacaaatattcattcaggaacagaagaa
aaaatccagaaacttctggaaaacagaaaaagactggatcacaagattgagctactgcag
gatgtaaaagaagtcatccttcctactccagagaacacggccagtacatcaagtacgatg
tctgaataa

DBGET integrated database retrieval system