KEGG   Parus major (Great Tit): 107211664Help
Entry
107211664         CDS       T04864                                 

Gene name
SETD1B
Definition
(RefSeq) histone-lysine N-methyltransferase SETD1B
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    107211664 (SETD1B)
Enzymes [BR:pmaj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107211664 (SETD1B)
Chromosome and associated proteins [BR:pmaj03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107211664 (SETD1B)
   HMT complexes
    COMPASS/SET1 complex
     107211664 (SETD1B)
    COMPASS/SET1 complex (yeast)
     107211664 (SETD1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1 RRM_5
Motif
Other DBs
NCBI-GeneID: 107211664
NCBI-ProteinID: XP_015499434
LinkDB All DBs
Position
15
AA seq 2005 aa AA seqDB search
MSFRETKAGEKAKHPEDHGKKQSSSWINGMENSTQASTSVEKRNHHWRSYKLIIDPALKK
GQHKLYRYDGQHFSMPNSGIAPVDCVRDPRIGRIWTKTKELELSVPKFKIDEFYVGPVPP
KQVTFAKLNDNIRENFLADMCKKYGEVEEVEILYNPKNKKHLGIAKVIFATVKGAREAVQ
HLHNTSVMGNIIHVELDTKGETRMRFYELLVNGLYTPQTLPVGTEQDVSPTGNEALQLTD
SLKRLKDSSLSSAGSSVTPNSSTPFSHDTAYSSCRQDTPNSYSQFTPQSQGTPHTPRLGT
PFSQDSTYSSRQTTPVYHFGQDSGYKPRRHETKFTDAYNRRPGHHYLHNSAGVFRGTEHQ
FSTFKSHQQEPVQFSHTPPLSHSSSSSYKSAFSPYQAPAVFPQSDEQPFPQTSRETEYRR
PAPPPTEMVVESSAAPSIDFVPVKEKPEEPPPLPDSNSVPEPSTASFSQTPERSETPGTP
TMESEMQHNSLDSRIEMLLKEQRTKLPFLNEHDSDNEIRMEGSPISSSSSQLSPIPTYGS
NSQPGFRGQTPSSRPSSTGLEDISPTPLPDSDDDEPIPGTASLSQNSRGTSEASMTPIDQ
LSRTSKIETLEAKEMVPGDQTPTSEKMDEGQHSSGEDMEISDDETNPAPITSAECAKTIV
VNSSVSNTAVLAPSIPPLPPPGFPPLPPPPPPQPGFPMPPPLPPPPPPTHPAVTVPPPPL
PAPPGVPPPHILPPLPPFHPGMFPVMQVDMISVLGNQWGGMPMSFQMQTQMLSRMMQAQN
TYQYPPFMTGRMQFVNLPPYRPFSMGAALARGQQWPPLPKFDPSVPPPGYEPKKEDPHKA
TVDGVLLVIVKELKAIMKRDLNRKMVEVVAFRAFDDWWDKKERLAKASLTPVKSGGELEE
KPKPKDRIASCLLENWNKGEGLGYEAIGLGIGLRGAIRLPSFKVKRKEPPEAASAGDQKR
IRPSTSVDDEDEESERDRDASDTTSELSKKDAEAVGLRRRPARPLELDSEGEEGDETSGK
EEESSSEKEEEQEEEGGLVKAAPGKEEEEDEEDEDDEDEDDDEDEDEDDEEETGIDTSDK
EEEQDSEEDVASPSSSKAEVESSDESEDSSEFESSSDSDDEDEEDDDDDEDEEEEEEEEV
AEDQSREAMVAEPEHEPAGLELPDDERETILDLYPVDDYMDATGLGLAEPALAVKDEGSE
EIKAGESECSQVPGASIAAETLKHLVMERDQETKLALSPICRPEEESEPTSMLEPEVQEG
PKPESQDEEAALCISTPVAVFGEPLPSKSSFFGKSEESSLEARAKAKPPSAAEEDERLPR
TPGREVMIHSETETLLLPAHKVPSSMLPLPSTPGKEESLVPPEKFPEQLLVTKTSVEEEI
PRTPGRDILAKSSHPLSKSQSTDTVPATPGSDAPLTGSSLTLSSPQVPGSPFSYPSQSPG
INSGIPRTPGRDFNFTPTFPEAGATIPCLLPGKKQSEDELEEKPFKEPLGASLTISMNSV
PSPIPFASPPQADFHMDMGLPPDEPIPVAALPCMHGDGRMPIEECKAEVKPGLLSPEVPP
GASILPPPPPPSVLPKRRPGRPRRSPPSVLSLDVYSGKTIEPPPMPVALVEGPVGKELLS
GHPDAYYGLKDPEAVTLDFRNDGFHEKIAAETVAEKLPFKELENQWNEDFKEEEAHAKPK
RQWRRQKKTSEELPMIPSPEYSPPQPQFRPRSEFEEMTILYDIWNGGIDEEDIKFMCITY
DRLLQQDNGMDWLNDTLWVFHPSTSFSTPKKKKRDDGMREHVTGCARSEGYYKIDKKDKL
KYLNNSRAFAEEPPADTQGMSIPAQPHASTRAGSERRSEQRRLLSSFTGSCDSDLLKFNQ
LKFRKKKLKFCKSHIHDWGLFAMEPIAADEMVIEYVGQNIRQVIADMREKRYEDEGIGSS
YMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQKKIVIYSKQHINVNEEITY
DYKFPIEDVKIPCLCGSENCRGTLN
NT seq 6018 nt NT seq  +upstreamnt  +downstreamnt
atgtctttccgagagaccaaggcgggggaaaaagccaagcaccctgaagatcatggcaaa
aagcagagttcaagttggatcaacggaatggagaatagcacgcaagccagcacttctgtc
gagaaaagaaatcaccattggagaagttacaagttgattattgacccggctctgaaaaaa
ggacagcacaaactctaccgttacgatgggcaacatttcagcatgcctaactcggggatc
gctcctgtggattgtgtcagggatcccagaatagggcgaatatggaccaaaactaaggag
ctggagctgtctgtccccaaattcaagattgatgaattttacgtggggccagtgcctccc
aagcaggtcacttttgccaagctgaatgacaacatccgtgaaaactttttggccgacatg
tgcaagaagtacggcgaagtggaagaggtggaaattctctacaaccccaagaacaagaag
cacctgggcattgccaaagtcatctttgccactgtcaagggtgcccgggaggctgtgcag
caccttcacaacacctctgtcatgggcaacatcatccacgtggagctggatacaaaaggt
gaaacccgcatgagattctatgaactgctggttaatggtctttacactcctcagaccctc
cctgtaggcactgaacaggatgtgtccccaactgggaatgaagctctccagttgacggac
tccctgaagcgcttgaaggacagttccctttcttccgctggatcctccgttaccccaaac
agcagcacgcccttttcccacgacacagcctattccagctgtcggcaagacaccccaaac
tcctacagccaattcaccccccagtcccaaggaacaccccacaccccacgcctggggaca
ccgttctcccaggattccacctactccagccgacagacaacgcctgtgtaccattttggg
caggacagtgggtacaaacccaggaggcacgagacgaaatttacggatgcgtacaaccgt
cgtccgggacaccactacctgcacaactcggcgggggtgttccgaggcacagagcatcag
tttagcacattcaaatcccatcagcaggagccagttcagttctctcacactcctcccctg
agccactctagttcttcgagctataaatctgccttctccccctaccaagcaccagctgtg
tttccccagtctgatgagcagccgtttccccaaacttccagggagacagagtaccggaga
cctgcgccgcctcccaccgagatggttgtggaaagcagcgctgccccgagcatcgatttt
gtcccagtgaaggagaaaccagaggagcctccgcccttgcccgactcaaactctgttcct
gaaccgagcacagcatccttctctcagactccagagaggagtgagacccctggcaccccc
accatggagtctgagatgcagcataacagtttagactcaaggattgagatgctcttaaaa
gagcagagaacaaaattaccttttcttaacgagcatgactcagataatgagatccgaatg
gaaggtagccctatttcctcctcttcttcccagctctcccccatcccaacatacggttcg
aactctcagcctggtttcaggggtcagacgccttcctcacgcccttccagcacaggcttg
gaggacatcagccccacacccttacctgactctgatgatgacgagcccatccctgggaca
gcttctctgagtcagaattcccgggggacatcggaggccagcatgactcccattgatcag
ctgagcaggacctccaaaattgagaccctggaggctaaagaaatggtacctggtgaccag
actccaacatcagaaaaaatggacgagggtcagcattcctcaggggaggacatggaaatc
tccgacgacgagaccaaccctgcgcccatcaccagcgcggaatgtgccaaaaccattgtg
gtgaactcctccgtcagcaacacggccgtgctggccccgtccatcccccctctgccacca
ccgggattccctcctcttcctcctccaccgcccccgcagcccggcttccccatgccccct
ccgctgcctccgccgccgccgcccacgcacccggccgtcaccgtgcccccgccgccgctg
cccgccccgcccggggtccctccgcctcacatcctgcccccgctgccccccttccatccc
ggcatgttcccggtcatgcaggtggatatgatcagtgtcttgggcaaccagtggggtggc
atgcccatgtccttccagatgcaaactcagatgctgagccgcatgatgcaggcgcagaac
acgtaccagtacccgcctttcatgacgggccggatgcagtttgtgaatcttcctccctac
cgcccgttctcgatgggagccgctctcgcccgcgggcagcagtggccgccgctgcccaag
tttgacccctcggttccacccccgggttatgagccgaagaaggaagatccccacaaagcc
actgtggatggagtcctcctggtcatagtgaaggaactaaaggccatcatgaaaagggac
ctgaaccgcaagatggttgaagtggtggcgttccgggcgtttgatgactggtgggacaag
aaggaacgtcttgcaaaagcgtctctcactccagtgaagtctggaggagaactggaggaa
aaaccaaagccaaaggatcgaattgcctcttgtcttctggagaactggaacaaaggagaa
gggctgggatatgaggcaatcggcttgggcattgggttacgaggggccatccggctgcca
tccttcaaggtgaaaagaaaggagccacctgaagctgcctcagcgggagatcagaagaga
atccggccttctacttctgtggatgatgaagatgaagagtctgagagggacagggatgct
tctgatacaacatctgagctgtcaaagaaggatgcagaggcagtggggctgcgacggcga
ccagcaaggccattggagcttgacagcgagggagaagaaggagatgagacatcagggaaa
gaggaagagtcctcctcagagaaggaagaggagcaggaagaagaaggaggcttggtgaaa
gcagcacctggcaaggaggaagaggaggatgaggaggatgaagatgatgaggatgaagat
gatgatgaagacgaggatgaagatgatgaggaggagacaggcatagatacaagtgacaag
gaggaggagcaggactccgaggaggatgtagcaagtccctcgtcttccaaggctgaagtt
gaatcatctgatgaaagtgaggactcctctgaatttgagtcaagttcagactcggatgat
gaagatgaggaggacgatgatgacgatgaagatgaggaggaggaagaggaggaagaggtg
gctgaagatcaaagcagagaagccatggttgctgagccagagcatgaacctgctggtctt
gagcttcctgatgatgagagggagactattttggacctgtatcctgtggatgactacatg
gatgcaacaggcttgggacttgccgagccagctttggctgtgaaagatgaaggcagtgaa
gaaatcaaggcaggggaaagtgagtgcagccaagtcccaggggcttctattgctgctgaa
actctgaaacacttggttatggaaagagaccaggagacaaaacttgcactctctcccatc
tgtaggccagaggaagagtccgaacccacttccatgctggagccagaggtacaggaaggt
ccaaagcctgaatctcaagatgaggaagcagctctctgtatctctactccagtggcagtc
tttggagaacctctgcccagcaaaagcagcttctttggcaagtctgaggagagcagcttg
gaagcccgagctaaagcaaagccgccgtcggcagcggaggaggacgagcggctgccccgc
acgcctggacgggaggtgatgatccactcagagactgagactctcctgcttccagcccac
aaggtgccatcctccatgcttcccttgccatcgactcctggcaaggaagaatctttagtc
cctccagaaaagttccctgaacaattactggtgaccaaaacgtccgtggaagaggagatt
cccaggactcccgggcgggacattttggccaagtcttcacaccccctctcgaagtcgcag
agcacggacactgttccagccacgccaggaagtgatgctccccttacaggaagcagcttg
accctcagttcccctcaagtcccagggagccccttttcctacccatcccaatctcctggc
attaacagtggcattcctcggactcctgggagagatttcaatttcacgcctactttccca
gaagctggtgctaccattccttgccttctgcctggcaagaaacagtcagaggatgagcta
gaagagaaaccctttaaagagcctcttggtgcttcccttacgatcagcatgaacagtgtt
ccttcccctatcccctttgccagccccccacaagcagatttccacatggacatgggtttg
ccgcctgatgagccaatacctgtagcagccctgccatgcatgcatggagatggaagaatg
cccatcgaggaatgcaaggcagaagtaaaacccggtttgctctccccagaagtaccccct
ggggcttctattcttcctccccctccaccaccttctgttcttcccaaaaggaggccgggt
cggccgaggcggtccccaccttctgtcctctcgctggatgtgtactcgggcaaaaccata
gagcctcctcccatgccagtggccttggtggaaggtcctgtgggcaaagagctgttgagt
ggacatcctgatgcctactatggactgaaagaccctgaagccgtcaccctggacttcagg
aatgacggtttccacgagaaaatagcagctgagacagttgcagagaaactgccattcaag
gagctggagaaccagtggaacgaagacttcaaggaagaagaagctcacgcaaaacctaag
agacagtggcgaaggcagaagaagacatcagaggagctgcccatgatcccttcccccgag
tattccccaccccagccgcagttcaggccgcgctccgagtttgaggagatgaccattttg
tatgacatctggaacggaggcatcgatgaggaggatatcaaattcatgtgtatcacatac
gaccgcttgttacagcaggacaacggtatggactggctcaatgacaccctgtgggttttc
catccttctaccagcttttctacccccaagaagaagaagagggatgacgggatgcgggag
catgtgacgggctgtgcacgaagcgaaggctattacaaaattgataagaaggacaaactc
aaatacctcaacaatagccgagcttttgcagaggagcctccagctgacacacagggtatg
agcatccctgcccaacctcacgcttccacccgggctggttccgagaggcgatcagagcag
cgcaggctcctctcctccttcactggtagctgcgacagtgacctgctcaagttcaaccag
ctcaagttccggaagaaaaaactaaaattctgcaagagccacattcacgattggggcctt
tttgctatggagcccattgcagctgatgagatggtgatcgagtacgtgggtcagaacatc
aggcaggtcattgctgacatgcgagagaagcgatacgaggatgagggcattggcagcagt
tacatgttcagagtcgaccacgacaccatcatcgatgccaccaaatgcgggaacttcgcc
aggtttatcaatcacagctgcaatccaaattgttatgctaaagtcatcacggtggagtct
caaaagaagatcgttatctactccaagcagcacatcaatgtgaacgaggaaattacctac
gactacaagtttccaattgaggatgtaaaaatcccgtgtctctgtggctctgagaactgc
aggggaaccctgaactga

DBGET integrated database retrieval system