KEGG   Parus major (Great Tit): 107212346Help
Entry
107212346         CDS       T04864                                 

Gene name
TK1
Definition
(RefSeq) thymidine kinase, cytosolic
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
pmaj  Parus major (Great Tit)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    107212346 (TK1)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    107212346 (TK1)
Enzymes [BR:pmaj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     107212346 (TK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
18
AA seq 223 aa AA seqDB search
MNCLTVPGVHPGSPSRPRGQIQVIFGPMFSGKSTELMRRVRRFQLAQYRCLLVKYAKDTR
YSSSGVSTHDKSTMEALPAGLLQDVYQEALAAAVIGIDEGQFFPDIVEFCETMANTGKTI
IVAALDGTFQRKAFGSILNLVPLAESVVKLNAVCMECFREASYTKRLGAEQEVEVIGGAD
KYHSVCRACYFRKRPQQAGTENKENVPLGLRQLETAAPRKIFT
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaactgcctgacggtgcccggtgtccaccccggctccccaagccgcccccgcgggcag
atacaggtgatcttcgggcccatgttctcaggaaagagcacggaactcatgcggcgagtg
cggcggttccagctcgcccagtaccggtgcctgctggtgaaatatgccaaggacacgcgc
tacagctcttctggggtctccacacacgacaagagcaccatggaggccctgcctgccggg
ctcctccaggacgtttaccaggaggcgctggctgccgccgtcatcggcatcgatgagggc
cagttcttcccagatattgtggagttctgcgagacaatggcaaacactgggaaaaccatc
attgttgctgctctggatgggactttccagaggaaggcctttgggagcatcctgaacctg
gtgccactggcggagagcgtggtgaagctgaacgctgtgtgcatggagtgcttccgggag
gcctcctacaccaagaggctgggagcagagcaggaggttgaagtgattggaggagctgac
aagtaccattctgtgtgccgagcctgctacttccgcaagcgaccccagcaggccgggaca
gagaacaaggagaacgtgcccctgggcctgaggcagctggagacagctgcccctcggaag
atcttcacttga

DBGET integrated database retrieval system