KEGG   Parus major (Great Tit): 107213046Help
Entry
107213046         CDS       T04864                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 6-like
  KO
K05624  
transglutaminase 6 [EC:2.3.2.13]
Organism
pmaj  Parus major (Great Tit)
Brite
Enzymes [BR:pmaj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     107213046
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
20
AA seq 704 aa AA seqDB search
MSCVFLALKIGKVNWQPKLNKAAHHTSDYSSTEVILRRGQPFNISLNLKTTAQSWDNFTF
IASTGPSPAESQQTKAIFSLSEEGASGWSATQEPSEPRCLNFTILSPADAVIGRYKLQLQ
LLAGNKISSKVLGQFVLLFNPWCPDDDVYMADEKERQEYVLNDSGIIFQGVEKDIQEEAW
NYGQFEEDILDISLAILDRSLNHREEPAVDVSQRSSPVYVSRVISAMVNSNDEKGVVEGK
WSGKFRSGTNPLRWSGSVTILRKWYRARYRPVRYGQCWVFAGVTCTVLRCLGIPTRVITN
FNSAHDKNLNLSIDKYIDVSGNNLHLSEDSVWNFHVWNESWFIRRDLGSFYDGWQVLDAT
PQEKSKGIYQCGPASTRAIKEGDVNLDYDSPFVFAAVNADCVTWIRYSKKRKERIYSDTR
KIGKFISTKAVGTNSRVDVTANYKYPEGSSKERQVYKKALKLLGVRRPGKRTKILRPRRR
FSRAQPAETPGISGKLLLDASPVIGQDILLTLTLRNSTSDFKTIKVKLKASAILYTRKPK
AEILQLHRSVKLGSEEVKEISFKISYSQYKNSLMDDRKILVTAVCQLKQGASLLVEKDIV
LQDSFLTIKVLGAAVVHKPVSVEVTFTNPLSEEVTDCVLRAEGSGLLKEQLRIQVERMAP
METSTVEFEIIPYRSGTRQLQVDLVCTHFSDIKGFVMLHVAPAQ
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgtgtctttctagccctaaaaataggaaaagtcaactggcaacccaaactaaat
aaagctgcacaccacacctctgattacagcagcacagaagtaatcttgaggagagggcag
cccttcaacatctctctgaacctcaaaacaacagcacaatcttgggacaacttcaccttt
attgcaagcacaggaccatctccagcagaatcccagcagaccaaggccatattttccctt
tctgaggagggtgccagtggctggagtgcaacccaagagcccagtgagcctcgctgcctg
aacttcaccatcctcagcccagccgatgctgtcatcggacgatacaaactccagctccag
ctccttgctgggaacaagatctcttccaaagtcctgggccagtttgtgctgctcttcaac
ccctggtgtccagatgatgatgtctacatggctgatgaaaaggagcggcaggaatatgtt
ctgaatgacagtggaatcatatttcagggagtggagaaagatattcaagaagaagcttgg
aactatggacagtttgaggaggacatccttgatatctcgctggctattctggatcggagc
ctgaaccaccgtgaggagccagctgtggatgtctcccagcggagcagccctgtctatgtg
agcagggttatcagtgccatggttaacagcaacgatgagaaaggagtagtggaagggaag
tggagcgggaagttccgctcgggaacaaaccccctgcgctggagcgggagcgtgaccatc
cttcggaagtggtaccgggccaggtaccgacccgtgcgctacggccagtgctgggtcttt
gcaggagtcacctgcacagtattgagatgcttgggaatacctactcgtgttattacaaac
ttcaactctgcccatgacaagaacctcaatctgagcattgataagtacattgacgtgtct
ggaaacaacttgcacttgagtgaagacagtgtgtggaatttccatgtctggaatgaaagc
tggtttattagaagagacctcggctctttttatgatggatggcaggttctggatgcaaca
ccccaggaaaaaagcaaaggcatctatcagtgtggtcctgcctccaccagagccattaaa
gaaggggatgtgaacctggattatgacagcccatttgtgtttgcagcagtgaatgctgac
tgtgttacttggattcgctatagcaagaaaagaaaagagagaatttattctgataccagg
aagattgggaaatttatcagcaccaaagcagtgggcaccaactcccgtgtggatgtcact
gccaattacaaatatccagaaggatcctcaaaagaaaggcaggtgtacaagaaggcactg
aagctgcttggtgtgagaagacctggaaaaagaaccaaaattctaagacccagaagacga
ttttcaagggcacagcctgcagaaacccccggcatctcggggaagctgctccttgatgca
tctcctgtgattggccaggacatcctccttaccctgacactcagaaactcgacctcagat
tttaagaccataaaggttaaactgaaggcttcagccattctctacaccagaaaacccaag
gcagagattctgcagttgcataggtctgttaaacttggatctgaggaagtgaaagagatt
tctttcaagatctcctattcccagtacaaaaactctctgatggatgacaggaagattcta
gtgactgctgtgtgtcaactcaaacagggagcctcacttctagttgagaaggatattgta
ctccaggattcttttctcaccatcaaggtcctgggtgcagctgtggtgcacaagcctgtc
agcgtggaggtgacatttaccaaccctctgtctgaggaggtgacagactgtgtcctgaga
gctgaaggcagtggcctgctcaaagagcagctccgaatccaagtggaaagaatggccccc
atggagacttcaacagtggaatttgaaatcattccctacaggagtggcaccaggcagctt
caggtggacttggtttgcacccacttttcagacattaagggatttgtgatgctccacgtg
gctcctgctcagtga

DBGET integrated database retrieval system