KEGG   Parus major (Great Tit): 107214568Help
Entry
107214568         CDS       T04864                                 

Gene name
ASH1L
Definition
(RefSeq) histone-lysine N-methyltransferase ASH1L isoform X1
  KO
K06101  
histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43]
Organism
pmaj  Parus major (Great Tit)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    107214568 (ASH1L)
Enzymes [BR:pmaj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107214568 (ASH1L)
Chromosome [BR:pmaj03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107214568 (ASH1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
25LG1
AA seq 3023 aa AA seqDB search
MDPRNTAMLGLGSDSEGFSGKSPSVVNIGTLVGKGEAELEGCTKDEEDGKKKSREGNAES
GKSEALGDAQQQFSVKETNFSEGNLKLKIGLQAKRTKKPPKNLENYVCRPAIKTSIKQPR
RAPKSGKMTEEKNEHCPSKQDPSKSYKKAGEVAAVELHVEEGHQVETAPLSKKVSPLHSE
MTDYIKSSPPTLISSHNSDLKDRTEINGAKTVTEKLAQLIATCPPSKSSKTKQKKPGSGN
GAASGLVKDSGKKLPGAITASGLVNKDLVKKLPGSGIAVGLVNKDSGKKPLGIGSAAIMV
NKDSGKKPQAISPLIGLVSKDSGKRPPGISTPTLVHKDSVKKQPVTSSAVGLISKDVGRK
LPGISTPTALTNKEPLKKPVGISTPAGLVNKDAGKKLLGINSPTGLLNKDSGRKMPGTGS
STVLVNKDSGRKTPGISSPMGPVSKDPGRKMPGISSPVGLVSKDCGKKPAGIGTPAGLAS
KDSGSLKADSLVPSSEPFKLPCNSNLSSLESHEPADLLKENTTSKTFEKHIMRQSKESIL
DKFSIRKEIADVGKEMFSEGMCVPQDAYSSSEKGIYETSKHEKQPPVYCTSPDFRTGGAS
EVSTAKSPFSAVGEGNLPSPSPTVSVPTLSRSLSTASSQLASNSLHLSSTAELLEGISDP
MGKAAFSDSSTLLSLNRTLNHSLSTDFKGAEKDLSDSKASYVETSRTSPPTGKKPILAAE
TSIHATVTPSVVSFTSLFGSKQFLKIGAIAASEKSCQGAKNLSSTQQSKPLKKRKGRKPR
WTKVVSRSACRPPKGLELERSELFKNISYSALSSSNLEQAKFLKNIGSSSFVEHEFVKHQ
LPKLNETNGQSLALLSETDKQTQKFYSAHKQPSSLCMSDDFLPDIYKPKRGRPKSKEMPE
LEGPPKRTLKIPASKVFSVQSKEEQEPPILQPEVEIPSLKQSLSGQGFPKKRGRPKRQIR
SSIKMKPPILSVAPFVGTENSNKMGPESDQHRPGEFFERKDQLRGPEEVQSPSICSMSDL
EVDSDRKVAKRNNGQLMKTIIRKINKMKTLKRKKLLNQILSSTVEPNTKGKMQSKLHNTV
STLAATFGSKLGQQINVSKKGTIYIGKRRGRKPKAVLNGILASSAASLTVLEKSAQQAPG
TSLGQVLPHLLPSAANPSEILPSPVCSQSSAVSGGQSPVSSDAGFIEPSSVPYLHLHSRQ
GSVVQTLAMKKAAKGRRRLSPPTLLPNSPSHLSELTSLKEATPSPVSESHSDETIPSDSG
IGTDNNSTSDRAEKFCGQKKKRHSFDHVSLIPPETSTVLSNLKEKHKHKCKRRSHDYLSY
DKMKRQKRKRKKKYPQLRGRQDPDFLAELEELISRLSEIRITHRSHHFIPRDLLPTIFRI
NFNSFYTHPTFPLDPLHYIRKPDLKKKRGRPPKMREAMAEMPFMHSLSFPLSSTGFYPSY
GMPYSPSPLAAAPIGLGYYGRYPPTLYPPPPSPSFTTPLPPPSYMHTGHLLLNPTKYHKK
KHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMAYGWMLEHKHRHRHKHREHRSSEQPQVSM
DTITANSSSRTVLESLKRYRFGKEAVGERYKHKEKHRCHMSCPHLSPSKGLLSRDEQWVR
REPSESNSLALGLQTPLQIDCSENSPALSLGGFTPSSEPASSDEHTNLFTSAIGSCRVTN
SASTNGRKKLPESPGLFSGQDASLGRPLRKEPLPSLEKPLSGTLPSQDKPSQRQSESTNC
SPSRKRSTSESTSSPGAAGAARGARLAPAAEDSVDTLLQRMAQQDGPPTLDKTLEAVMAN
VSAPAAASPARNHSRERALGKQDGLGAPAMAGSDGISLLQERLPGTYSPRHLKRSVVEAM
QRQARKMCNYNKILATKKNLDHVNKILKAKKLQRQSRTGNNFVKRRPGRPRKYPMQAVVS
MQAFQAARLVSQELQDREQSSSPLHLGPDTITDVIEAVVQSVNLNPEHRKGWKRKRWLPE
EQARKRHKSLPEDEQESNKSFSETVAEPPSPHEALGKPPESETPEQPLPPLTQREKKAPR
PPKKKYQKAGLYSDVYKTTDPKSRLIQLKKEKLEYTPGEHEHGLFPAPIHVGKYLRQKRI
DFQLPYDILWQWKHNQLYKKPDVPLYKKIRSNVYVDVKPLSGYEATTCNCKKPEDDSGKG
CVEDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRAEEKGWGIRTKEPLKAG
QFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDSYRMGNEARFINHSCNPN
CEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVEKQQLCKCGFDKCRGIIGGKS
QRMNGLSSKSNQPVSTHRRPGRSKEKRKSKHKLKKRRGHIPEEPSESVNAPTRLTPQLQM
KPMSNRERNFVLKHHVFLVRNWEKIRQKQEEVKHVSDSMHSSSLYTRWNGICRDDGNIKS
DVFMTQFSALQTARSVRTRRLAAAEENLEVARAARLAQIFKEICDSIISYKGEDSSRQAL
AAPLLNLPPKKKNADYYEKISDPLDLATIEKQILTGYYKTVEAFDGDMLKVFRNAEKYYG
RKSPTGRDVCRLRKAYYSARHEASAQIDEIVGETASEADSSETSVGDKDNGHEKDEDVIR
CICGLYKDEGLMIQCEKCMVWQHCDCMGVNSDVEHYLCEQCEPRAVNREVPMIPRPHYAQ
PGCVYYICLLRDDLLLRQGDCVYLMRDSRRTPDGHPVRQSYRLLSHINRDKLDIFRIEKL
WKNEKEERFAFGHHYFRPHETHHSPSRKFYHNELFRVPLYEIIPLEAVVGTCCVLDLYTY
CKGRPKGVKEQDVYICDYRLDKSAHLFYKIHRNRYPVCTKPYAFDHFPKKLTPKRDFSPH
YVPDNYKRNGGRSSWKSDRSKPQIKDLNQEEDSLPLMEEVLGAPEQAPGELPSPEEPDKE
PVASESCEADKKGDTENPSDTRPLCSPEERRHLQRERLNQILLNLLEKIPGKNAIDVTYL
LEEGSGRKLRRRTLSIPESSFRK
NT seq 9072 nt NT seq  +upstreamnt  +downstreamnt
atggaccctcggaatactgctatgttaggcttgggttctgattctgaagggttttctggg
aaaagcccctctgtggtaaacattggcacattggtgggcaaaggggaagcagagctcgaa
ggctgcaccaaggacgaggaggacgggaagaagaagagccgggaggggaacgcggagagc
ggcaagagcgaagctctgggcgatgcacagcagcaattctcggtgaaggaaacaaacttc
tcagagggaaacctgaaactgaagattggccttcaagcaaagcggacaaaaaagcctccc
aagaacctggagaattatgtctgccggcctgccataaaaaccagcatcaagcagccaaga
agggctcccaagagtgggaagatgacagaggagaagaacgagcactgtccttcgaagcaa
gacccttcaaagtcttacaagaaagctggagaagttgcagcagttgagttacacgtggaa
gaaggtcaccaagtagaaacagcccctttatctaagaaagtttccccactgcattctgaa
atgacagattatataaagtcatctcctccgactcttatcagtagccataattctgactta
aaggatagaacagaaattaatggagcaaaaactgtcacagaaaaattggctcaacttatt
gcaacctgtcctccttccaagtcttccaagacaaagcagaagaagcctggaagtggaaat
ggagctgcgtctggtttggtgaaagactctgggaagaagctgccaggagccataactgcg
agtgggctggttaacaaagatttggtgaagaaactgccaggctctgggattgctgttggg
ttggtgaacaaggactcagggaagaagccattagggattggcagtgcagccataatggtt
aataaagactctgggaagaagccccaagcaatcagccccttaattggattggttagcaag
gattctgggaagagacctccagggatcagcactccaacattagtccacaaggattcggtg
aagaagcagccagtgaccagctctgcagttggattgatcagcaaagatgtggggaggaaa
cttccagggatcagcactccaactgcactgactaacaaggagcctctcaagaagccagta
gggatcagcactccagcaggattggttaacaaagatgctgggaagaagttgttgggaata
aacagccctacaggtctgcttaacaaggattctgggaggaagatgccagggactgggagc
agcacagttctggttaacaaagactctggaaggaagacaccagggattagcagcccgatg
ggaccggttagcaaggaccctgggaggaagatgccaggaattagcagtcccgtggggttg
gttagcaaggactgtgggaagaagccagcagggattggcactccagctggtttggctagc
aaggactctggaagtctgaaagcagactccctcgtgccctcctcagagccctttaagctt
ccttgcaattcaaacctcagcagccttgaaagccatgagcctgcggatttactgaaggaa
aatactaccagcaaaacctttgagaagcacattatgagacagagcaaagaaagtatcttg
gacaagttttcaattcggaaagaaattgctgatgtaggcaaagagatgttcagtgaagga
atgtgtgttccacaggatgcctactcatccagtgagaaagggatttatgaaacgtctaag
cacgaaaagcagcctcctgtttattgcacttcaccagacttcaggacaggaggtgcctcg
gaggtgtcgacagccaagtccccgttcagtgcagtgggagaggggaatctcccatctcct
tcccccaccgtgtctgtccccaccctgagcaggagcctctccacagcctcctcccagctg
gcgtccaactcattgcacttaagttccacggcagagctcttggaaggcatttcagatccg
atgggcaaagcagcattctcagacagcagcaccctcctgagcctgaacaggacattgaac
cacagcctcagcaccgattttaaaggtgctgagaaagacttaagtgattcaaaagcatct
tacgtggaaacttcaagaacaagtcctcccacagggaaaaagcccattttggcagctgag
acgagcatccacgctactgtcaccccttcagtagttagtttcaccagcttgtttggtagc
aagcagttcctcaagatcggtgcaatagctgcatccgagaaatcctgccaaggagcaaaa
aacctgagcagcactcagcaatccaaacctttaaagaaaaggaaaggaaggaagccacga
tggactaaagtggtgtcaagaagcgcgtgccgacctccaaagggtctggaactagaaagg
tcagagctttttaaaaacatttcatacagtgcactatcaagcagtaatttggagcaggcc
aaattcctgaaaaacatcggatcctcctcatttgtggagcacgaatttgtcaaacatcag
ttgccaaagctgaatgaaactaatggacagtctctggcactgctgtctgagactgacaaa
caaactcagaagttctacagtgctcacaaacaaccctccagcttgtgtatgtcggatgat
ttcttacctgacatatacaaacccaagagaggaagacctaaatccaaggagatgccagaa
ctcgaaggtccccccaaaagaactcttaagatcccagcatcaaaagtcttctcagtacag
tcaaaagaagagcaagaacctccaattttgcagcctgaagtcgaaattccctccctaaag
caaagcttatcaggacaaggttttcctaaaaagagagggagacccaaaaggcagatccgg
tcatcgattaaaatgaaacctcctattctgtctgtggcaccttttgttggaacagagaac
tcaaataagatggggcctgaaagtgatcagcatcgacctggggagttctttgagaggaag
gaccagctccgagggccagaagaagtccagagccccagtatttgtagcatgagtgatttg
gaagtagactcagacagaaaagttgccaagagaaataatggacagttaatgaaaacaatt
attcgaaaaataaataaaatgaaaactctgaagcgaaagaaacttctgaatcagattctg
tccagtacagtggaaccaaataccaaagggaagatgcaatccaagctccacaacaccgtg
tcaactcttgctgccacatttggttcaaaactaggccagcaaatcaatgtcagcaagaaa
ggaacgatttacataggaaaaaggagagggaggaaacctaaagctgtcctgaatggcatt
ttagccagcagcgctgccagtctgacagttctggagaagtctgcccagcaagctcctggt
acgtccctgggacaagtccttccccacctgctgccctcggcagccaatccctccgagatc
ctcccgtccccggtttgctcgcagtcctcggccgtgagcggggggcagagccccgtgagc
agcgacgcggggttcatcgagcccagctcggtgccctacctgcacctccactccaggcag
ggcagcgtggtccagacgctcgccatgaagaaagcagccaaggggaggaggaggttgtca
ccacccacgctgctgcccaactccccgtcccacctgagcgagctgacatcgctgaaagag
gccaccccttcccccgtgagcgagtcccacagcgacgagaccatccccagcgacagcggg
ataggcaccgacaacaacagcacttcggaccgggccgagaagttctgcgggcagaagaag
aaaaggcactcgttcgaccacgtgtccctcatcccacccgagacttccaccgtgctgagc
aacctgaaggaaaagcacaaacacaagtgcaagcgccgcagccacgattacctcagctac
gacaagatgaagaggcagaagcgaaaaaggaaaaagaagtatccccagctccgagggagg
caggaccccgacttcctcgctgagttagaggagttaataagtcgattaagtgaaattaga
ataacccacagaagtcaccattttataccccgagacttgctgcctaccatttttaggata
aatttcaatagtttctacacccaccctacttttcctttagatcctttgcactacattaga
aaacctgatttaaagaaaaagagaggcaggcctccaaaaatgcgagaagcgatggcagaa
atgcctttcatgcatagcctgagctttcccctgtccagcaccgggttctacccctcctat
ggcatgccttactccccttctcccctggcagctgctcccataggattaggttattatgga
aggtaccctccaactctttaccctcctccaccctctccttcattcaccactcccctgccc
ccaccttcctacatgcatacaggccacctgcttctcaaccccactaaataccacaagaag
aagcataaactcttgcgccaggaagcgttcctcaccacgagcaggactcctctgctgtcc
atgagcacgtaccccagcgtcccacccgagatggcctacggctggatgctggaacacaag
cacaggcaccgccacaagcaccgggagcatcgctcttccgagcagccgcaggtttccatg
gacaccatcacggccaacagctcctccagaaccgttctggagtccttgaagcgctacagg
tttgggaaggaggctgtcggcgagaggtacaaacataaagagaaacacaggtgccacatg
tcttgtcctcacctgtcaccttccaagggtttgctgagcagagatgagcagtgggtcagg
agagagccctcggagtctaattccttggcgctggggttgcagacacctctgcagatagac
tgctctgaaaactccccagctctgtccctggggggattcactcccagctcggagccagcc
agcagcgatgaacacacaaaccttttcacaagtgcaataggcagctgcagagtcaccaac
tctgccagcaccaacgggcgtaaaaagttacccgagagccccggactgttcagcgggcag
gacgcgtcgctcggccggcccctccgcaaggagcccctgccttccctggagaagccactg
tcaggcactttgccaagccaggacaaaccctcgcagaggcagtcggagagcacaaactgc
agcccttccaggaagagatccacgtcggagagcacttcttctccaggggcggcaggagcg
gcgcggggcgcgcgcctggccccggcggccgaggactcggtggacacgctgctgcagcgc
atggcccagcaggacgggccccccacgctggacaagaccttggaagccgtcatggccaac
gtgtctgcccctgcagcggccagccctgcccggaaccactccagggagagagccctgggc
aagcaggacgggctgggggctccggccatggccggcagcgacggcatctccctgctgcag
gagcgcctgcccggcacctactccccacggcacctcaagaggagcgtggtggaggccatg
cagcgccaagcgaggaaaatgtgcaattacaacaagatcctggcgacaaaaaaaaatctg
gaccacgtcaacaaaatcctgaaagccaaaaagctgcagaggcagtcgcggaccgggaat
aacttcgtgaagcggcggccggggcggccgcgcaagtacccgatgcaggccgtggtgtcc
atgcaggccttccaggccgccaggctggtcagccaggagctgcaggacagggagcagagc
agcagccccctgcacctggggccagacaccatcacagatgtcatcgaagccgtggtgcag
agcgtgaatctaaaccccgagcaccgcaaaggttggaagaggaagaggtggctgccggag
gaacaggccaggaagagacacaagtctttgcctgaagatgagcaggagagcaataagagt
ttctctgagacagtagctgaacctcccagtccacatgaggcccttgggaaaccacctgaa
tctgaaacccctgagcagcctttgcctcctctaacccagcgtgagaagaaagcccctcga
cccccaaagaagaagtaccagaaggctgggctctactctgatgtgtacaaaacaacagac
cccaagagccgcctgatccagctgaagaaggagaagctggaatacaccccaggggagcac
gagcacgggctgttcccagccccaatccacgttgggaagtacctcagacaaaagagaatc
gacttccagctgccttacgacatcctctggcagtggaaacacaaccagttgtataaaaag
ccagatgtcccactttataaaaaaatccgttccaatgtctatgtggatgtcaaacctctc
tctggctacgaggccaccacctgcaattgtaagaaaccagaggatgacagtgggaagggc
tgcgtggaggattgtctgaacaggatgatctttgcagagtgttcccccaacacgtgtccc
tgcggggagcagtgctgcaaccagcgcatccagaggcacgagtgggtgcagtgcctggag
aggttccgtgccgaggagaaaggatggggtatccgcaccaaagaacccctgaaagcagga
cagttcatcattgaatatctgggagaagttgttagtgagcaagaattcaggaaccggatg
attgagcagtaccacaaccacagtgaccattactgcctgaacctggacagcggcatggtc
atcgacagctaccgcatgggcaacgaggctcgcttcatcaaccacagctgcaaccccaac
tgtgagatgcagaaatggtctgtgaatggtgtgtatcggatcgggctctatgcactcaag
gacatgcctgctgggactgagctcacctatgactacaacttccactcatttaacgttgaa
aaacagcaactctgcaaatgtggctttgacaaatgcagaggaataattgggggtaaaagt
caacgcatgaatggactctcaagcaaaagcaaccaacctgtgagcacccacagaagacct
gggaggtcgaaagagaagaggaagtcaaagcacaaactaaagaagagaaggggccatatc
cccgaggagcccagcgagagtgtgaacgccccaaccaggctgactccgcagctgcagatg
aagcccatgtctaacagggaaaggaattttgtgctaaaacaccacgtgttcttggtacgg
aactgggagaagatccggcagaagcaggaggaggtgaagcacgtcagtgacagcatgcac
agctcgtcgctctacacccgctggaacgggatctgccgcgacgacggcaacatcaaatca
gatgtgttcatgacccagttctcggcgctgcagacggcgcgctcggtgcggacgcggcgc
ttggccgcggctgaggagaacctcgaggtggctcgtgccgcccgcctggctcagatcttc
aaggagatatgtgacagcatcatatcctacaaaggtgaagactcctccaggcaggcgctc
gcagctcctctcctcaacctgcccccaaagaaaaaaaatgcagactattatgaaaagatc
tctgaccccttggaccttgccaccattgagaagcagatcctgactggctactacaaaact
gtggaagcttttgatggggacatgctgaaggtcttcaggaatgcagagaaatactacggc
aggaagtccccgacggggcgggacgtgtgccggctgcgcaaggcctactacagcgcgcgg
cacgaggcctcggcacagatcgacgagatcgtgggggagacggcgagcgaggccgacagc
agcgagacctcggtgggcgacaaggacaacgggcacgagaaggacgaggacgtcatccgc
tgcatctgtggcctctacaaggacgaggggctcatgatccagtgtgaaaagtgcatggtg
tggcagcactgtgactgcatgggtgtgaattcagacgttgagcactacctgtgtgagcag
tgtgaacctcgagctgtgaacagggaggttcccatgatccctcgtccccactatgcccag
cctggctgtgtttattacatctgcctgttgagggatgatctgctgctccgccaaggtgac
tgtgtgtacctgatgagagacagccgcaggacccccgacgggcacccggtgcgacagtcg
taccgcctgttgtcccacatcaaccgcgacaagctcgacatcttccgcatcgagaaactc
tggaaaaacgagaaagaggagcgtttcgcctttggccaccactatttccgtccacacgaa
acgcatcattccccgtctcgcaagttctaccacaacgagctgttccgggtgcccctgtac
gaaatcatccccttggaggccgtggtggggacgtgctgtgtgctagacctgtacacctac
tgcaaagggaggccgaagggtgtgaaggagcaggatgtttacatctgtgattaccgcctg
gataaatcagctcacctcttctacaagatccaccggaaccgctaccccgtgtgcaccaag
ccctacgccttcgaccacttccccaagaaactcacgcccaagagggatttctcacctcat
tatgtgccagacaactacaagagaaacggaggcaggtcatcctggaaatccgatcgctcc
aaaccacagatcaaagacttaaaccaagaggaagattcccttcccctgatggaagaggtg
ctgggggcccctgagcaggctccaggggagctgcccagccccgaggagcccgacaaggag
ccggtggccagcgagagctgcgaggctgacaagaagggggacaccgagaacccctcggac
acgaggccgctctgcagccccgaggagcggcggcacctccagagggagaggctgaaccag
atcctgctcaacctcctcgagaaaatcccagggaaaaacgccatcgatgtcacctacctg
ctggaggagggctcgggacggaaactgcggcgccgcactctgagcatccccgagagcagc
ttcaggaagtga

DBGET integrated database retrieval system