KEGG   Parus major (Great Tit): 107215307Help
Entry
107215307         CDS       T04864                                 

Gene name
MAP3K14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14 isoform X1
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj04010  MAPK signaling pathway
pmaj04210  Apoptosis
pmaj04625  C-type lectin receptor signaling pathway
pmaj04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    107215307 (MAP3K14)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    107215307 (MAP3K14)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    107215307 (MAP3K14)
   04672 Intestinal immune network for IgA production
    107215307 (MAP3K14)
Enzymes [BR:pmaj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     107215307 (MAP3K14)
Protein kinases [BR:pmaj01001]
 Serine/threonine kinases: STE group
  Other
   107215307 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo
Motif
Other DBs
NCBI-GeneID: 107215307
NCBI-ProteinID: XP_015506885
LinkDB All DBs
Position
27
AA seq 939 aa AA seqDB search
MAVMGIECQGAPDPAIKHKKEPTAAKGLKETVSEKQSSVCKVEDSKKVIFHSQWKILNDV
ITKGTAKEETEGGCASISIIAQAECENSQEFSPTLSERSFIAHSKRYSSRSDSLDHIPNN
VAHATEGRMAPTWRGRHRGRAKKKRHKKRSKLKGQPVAAGRRSPRTPEQESCTPIPVQED
ESHQSTLYRNSFWVPEFNKDLGYDPLSFEKCAHAPLSTGKLHSPRSQYKTELHKLISPIQ
CLNHVWKQRDTVPQPETLHPFPYNILPPHFPLVDNPLHAMKHSALDTYFNGDLNYQDSRL
SGLNLEYNFTKYINQSVQTSSDKLSVEEYLVDALKGSVSFGEPQNLASLAKTWRGGGLEL
KEQFHEASENEGVLLNEKLKPVDYEYREEVHWTKCHGSLGIGSFGEVYKIEDKQTGFQCA
AKKVQVEHFRAEELTMCAAVTSPSVVPLYGAVKEGPWVTIFMKLMEGGSLGQLIKQSGCL
PEDRALSYLGQVLEGLEYLHAQNILHGDVKAENVLLSDDGSRALLCDFGHSAHLHPDGLG
KCLVTGNYVPGTETHMAPEVVMGKRCDSKVDVWSSCCMMLHMLNGCHPWTQYYNHPLCLK
IAKEPPPLREIPPSCNPLTAEIIKLGLEKEPLHRASASELKTKTCVALEEVGGVRSPWKG
EYREPRHLSLSKENSAQTSLSPTVSPVSETGSDPKLSVKVSCASPVPPPPSLEQTEEVEG
SHWNEGKELPETWDPPPLSSTPLPLKSCSHMERATTISEQELQQLEIELFLNSLSQPYSL
EEQEQMLSCLSIDSPFVSDASEKNSMKASQSLRDTMSSGIHSWNSQADGQSCSWNNLLSR
SRHTDTPSYFNGVKIQIQLLSGENLHIRDFHRTKVGDIATGISSQIPVPAFSLVTKEGQP
VRYDMEVPDSGIELQCTLAPDCSVSWAWRVKHGQLENRP
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatgggaattgaatgccagggagctcctgatccagccatcaagcacaaaaag
gagcccacagctgccaaggggctgaaggagacagtgagtgaaaagcagagcagtgtttgc
aaagtagaagattcaaagaaggtcatctttcacagtcagtggaaaatcctgaatgatgta
atcaccaaaggaacagcaaaagaagaaacagaaggaggctgtgcatcaatttctattatt
gcccaagcagaatgtgaaaacagtcaggagttcagccccactttatcagagagatccttt
attgcccacagtaaacgttacagcagccgctcggacagcctcgatcacatccccaacaat
gtggcccatgccacggagggcaggatggcgcccacctggcgagggaggcaccggggcagg
gccaagaagaaacggcacaagaaaagatccaagctgaaaggacaacctgtggctgctggc
aggagaagtccaagaactccagaacaggagagctgcaccccaattcctgtccaggaggat
gaatcccaccaaagtactctttacagaaacagtttttgggttcctgaatttaacaaagac
ttgggctacgatccactgtcttttgagaagtgtgctcatgctcctttgtccacgggcaaa
ctccattccccaaggagccaatacaaaactgaactgcacaagctgatcagccctattcag
tgccttaatcatgtttggaaacagagggacactgttccccagcctgagactctccatcct
tttccctacaacatccttcccccacatttcccacttgtggacaatcctctccatgccatg
aagcacagtgctctggacacatacttcaatggtgacctcaactatcaagacagtcgctta
tctggcctaaacttagaatataatttcaccaaatacatcaaccagtccgtgcaaaccagt
tcagacaagctttctgtggaagaatatttggtagatgccttgaaggggagcgtgagtttt
ggtgaaccacaaaatttagccagcctggccaagacgtggagaggaggtgggctggagctg
aaggaacaattccatgaagcgagtgagaatgaaggcgtgctgctgaacgagaagttgaag
ccagtggattacgagtaccgagaagaggttcactggacaaagtgccatggttccttgggc
attggctcttttggggaagtgtacaagatagaggacaagcagacaggatttcagtgtgct
gccaagaaggtgcaggtggaacacttccgtgccgaggagctgacgatgtgcgcggccgtg
acgagccccagcgtggtgcccctgtacggagccgtcaaggagggcccctgggtcaccatc
ttcatgaagctgatggagggtggctcattagggcagctcattaaacagagtggctgcctg
ccagaggacagagccctcagctacctgggccaggtgttagagggtctggagtatcttcat
gctcaaaacattctccatggagatgtcaaagcggagaacgtgctgctgtcggacgatggg
agcagggccctcctgtgtgactttggccactctgctcacctgcacccagatgggctggga
aagtgcttggtcacagggaactacgtgcctggcacagagacccacatggccccggaggtg
gtgatggggaagcgctgtgactccaaggtggacgtgtggagcagctgctgtatgatgctg
cacatgctcaacggctgccacccctggacccagtactacaaccaccctctgtgcctgaag
atcgctaaagagccgcctcctctgagggaaattccaccttcctgcaaccctctcactgct
gagattattaaactggggctggagaaggagcctctgcacagggcatctgcatcagagctc
aaaactaagacctgtgtggcactcgaggaagtgggaggtgtgagaagcccctggaaaggt
gaatacagagagcccagacatttatctttgagcaaagaaaacagtgcacagacatccctg
tcccctacagtgagcccagtttctgagactggttctgacccaaaactgtcagtcaaagtt
tcctgtgccagcccagtcccaccacctccatctctggagcaaacagaggaggttgaggga
agccactggaatgagggcaaggagttacctgagacctgggaccccccacctctctcctca
actcctctgcccctgaagagctgcagccacatggaaagagccacaaccatttcagagcaa
gaacttcagcagctggaaattgaactgtttctgaacagcctttcccagccttactctctg
gaagagcaagagcaaatgctttcatgcctcagcatcgacagcccctttgtgtcagatgcc
agtgagaagaactctatgaaggcttctcagagcttgagggacaccatgagctctgggatc
cattcctggaacagccaggcagacgggcagagctgcagctggaacaacctgctgagccgc
agccggcacacggacactcccagctacttcaacggagtgaaaatccagatccagttgcta
agtggagaaaatttgcacatcagagatttccacaggacaaaggtgggagacattgccaca
gggataagcagccagatccctgtgcctgccttcagcctggtgaccaaggaggggcagcct
gtgcgctatgacatggaggtgcctgactctggcatcgagctgcagtgcaccctggccccc
gactgcagcgtcagctgggcctggcgcgtcaagcacggccagctggagaacaggccctga

DBGET integrated database retrieval system