KEGG   Parus major (Great Tit): 107215323Help
Entry
107215323         CDS       T04864                                 

Gene name
ACE
Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
pmaj  Parus major (Great Tit)
Brite
Enzymes [BR:pmaj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     107215323 (ACE)
Peptidases [BR:pmaj01002]
 Metallo Peptidases
  Family M2
   107215323 (ACE)
Exosome [BR:pmaj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107215323 (ACE)
CD molecules [BR:pmaj04090]
 Proteins
  107215323 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
27
AA seq 1277 aa AA seqDB search
MPAALGLLLGLSLAGALQPGLEPPQHEPTEEGATSFARDYNSTAELVFFESVSASWNYTT
NLTAENAALQVKASLEEQNFTELWGKKAKELYGDKWNNFSDPQLRKIIGSIQTLGPSNLP
LEMREQYNTILSDMDKIYSTAKVCLPNGTCWDLEPDLSDIMATSRSYKKLLYAWEGWHNA
AGNPLRPKYEEFVKLSNDAYMMDGFNDTGSYWRSWYDSDSFEKDLERIYTQLEPLYLNLH
AFVRRKLYDHYGPKYINLKGPIPAHLLGNMWAQQWNNIYDLMIPYPEKPNLDVTSSMVQQ
GWNATHMFRVSEEFFTSLGLLEMPTEFWKKSMLEKPTDGREVVCHASAWDFYNRKDFRIK
QCTSVTMEQLFTVHHEMGHIQYYLQYKDQPVSFRSGANPGFHEAIGDVLSLSVSTPSHLK
KIGLLSSAAEDEESNINYLLKMALEKIAFLPFGYLIDQWRWNVFSGHTPPSRYNYDWWYL
RTKYQGICAPVPRNESNFDPGAKYHIPGNTPYIRYFVSFILQFQFHKALCEAANHKGSLH
TCDIYRSKEAGAKLREVLKAGSSKSWQDILLNLTGMGQMDAAPLLEYFSPVTKWLQEQNN
KTNEVLGWPEFDWRPPVPEGYPEGIDKIADEAQAKEFLSEYNTTAEEVWNAYTEASWAYN
TNITDHNKEIMLEKNLAMSKHTLEYGMRARQFDTSDFQDQSVIRILKKLSVIERAALPEN
ELKEYNTLLSDMETTYSVAKVCRENKTCHPLDPDLTDIMATSRDYDELLFAWKGWRDASG
KKMRNNYKRYVELSNKAALLNGYKDNGAYWRSLYETSTFEEDLERLYLQLQPLYLNLHAY
VRRALYKKYGAEHINLKGPIPAHLLGNMWAQSWSNIFDLVIPFPDATKVDATPAMKKQGW
TPKKMFEESDRFFTSLGLIPMPQEFWEKSMIEKPSDGREVVCHASAWDFYNRKDFRIKQC
TVVNMDDLITVHHEMGHVQYFLQYKDQPVSFRDGANPGFHEAVGDVMALSVSTPKHLHSI
NLLDQVMENEESDINYLMSIALDKIAFLPFGYLMDQWRWKVFDGRIKDDEYNKEWWNLRM
KYQGLCPPALRSEDDFDPGAKFHIPANVPYIRYFVSFVIQFQFHQALCDAAGHKGPLHTC
DIYQSQEAGKILGDALKLGFSKPWPEAMQLITGQPNMSAEALMSYFEPLMTWLEKENKKN
GEVLGWPEYSWTPYTAQDDSSKTDFLGMFLTKSQATAGGWVLLALALIFLLTTIFLGVKF
FSARRKAFKSSSEMELK
NT seq 3834 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcggcgctggggctgctgctcgggctgagcctggcaggtgcccttcagcccggc
ctcgagcccccccagcatgaacccaccgaggaaggggccaccagcttcgccagagactac
aacagcacggccgagctcgtcttcttcgagagcgtctcggccagctggaattacaccacc
aacctgacggcggaaaatgctgctctgcaggtcaaggcatcactggaggagcagaacttc
acagagttatgggggaagaaagccaaggaactctatggtgacaagtggaataacttcagt
gacccccagctgaggaaaatcattggatccattcagaccttgggaccctccaacctgccc
ctggagatgagagagcagtataacaccatcctgagtgacatggacaaaatctactccacg
gccaaggtgtgcctgcccaatggcacctgctgggatctggagccagacctctcggacatc
atggccacctctcgcagctacaagaagctgctgtacgcctgggaggggtggcacaacgct
gcggggaacccgctgcgccccaagtacgaggagttcgtgaagctgagcaatgacgcctac
atgatggatggattcaatgacacaggcagctactggcgctcctggtatgactcagactcc
tttgagaaggacctggagcgcatctacacccagctggagccactctacctcaacctgcat
gcctttgtccggaggaagctgtatgatcactatgggcccaaatacatcaacctgaagggt
cccatccctgctcacctcctggggaatatgtgggctcagcagtggaacaacatctatgac
ctgatgatcccctaccctgagaagcctaaccttgatgtcacgagcagcatggtgcagcag
ggttggaatgccacccacatgttccgagtctcggaggagttcttcacctccctggggctt
ctggagatgcccactgaattctggaagaagtccatgctggaaaagccgacagatgggcgg
gaggtggtgtgtcatgcctcagcctgggacttctacaaccgcaaggacttcaggatcaag
caatgcacatcagtgaccatggagcagctgttcacagtgcaccatgagatgggccacatc
cagtactacctgcaatacaaggaccagcccgtgtccttccgcagtggggccaatcctggc
ttccatgaggccatcggcgatgtcctgtccctctctgtctccactcccagccacctcaag
aaaattggtctcctcagcagtgctgctgaggatgaagagagcaatatcaactacctgctg
aaaatggccctggagaagattgccttcctgccctttggctacctcatcgaccagtggcgc
tggaatgtgttcagtggccacacgccgccaagccgttacaactacgactggtggtatctg
agaaccaaataccagggtatctgtgctcccgttccaaggaatgaaagcaactttgaccct
ggagcaaagtaccacatcccggggaacactccttacatcaggtactttgtgagcttcatc
ctccagttccagtttcacaaggccctgtgcgaggcagccaaccacaaaggttccttgcac
acctgtgacatctacaggtccaaagaggctggagccaaactcagggaagtgttgaaagct
gggtcctcgaagtcatggcaggatatcctcttgaatctcaccggcatgggtcagatggat
gctgctccccttctggagtatttcagccctgtcaccaaatggcttcaggagcagaacaac
aagaccaacgaggtcctgggctggcctgagtttgactggcgtccccctgtccctgaaggc
taccctgaaggcattgacaaaatagcagatgaggcacaagctaaagagttcttgtctgag
tacaacaccacagctgaggaagtgtggaatgcctacaccgaggcatcctgggcctacaac
accaacatcaccgaccacaacaaggagatcatgctggagaagaacttggccatgtccaag
cacaccctggagtacggcatgagggccaggcagtttgacacctcagatttccaggaccaa
agtgtcatccgcatcctcaagaagctgagtgtcattgagagggcagccctacccgagaat
gagctgaaggagtataacacccttctctcagatatggagaccacatacagcgtggccaag
gtctgcagagagaacaaaacctgtcacccattagatcctgacctcacagacatcatggcc
acctctcgggactatgatgagctcctctttgcctggaagggctggcgggatgcttctggg
aagaagatgaggaacaactacaagcgatatgtggaactgagcaacaaggcagccctgctc
aatggctacaaagacaacggggcctactggagatccctgtatgagacatccacctttgag
gaagatctggagaggctgtatctgcagctgcagcccctgtacctcaacctacatgcttat
gtacgccgagccctctacaaaaagtatggtgcagagcacataaacctgaagggtcccatc
cctgcccatctgctaggcaacatgtgggctcagtcatggtccaacattttcgacctggtg
atacctttcccagatgccaccaaggtggatgccaccccagccatgaaaaaacagggctgg
acacccaaaaaaatgtttgaagagtcagaccgttttttcacctctctgggcctcatcccc
atgccacaggagttctgggagaagtccatgatcgagaagccatcagatgggcgggaggtg
gtgtgtcatgcctcggcctgggatttctacaatcgcaaggacttcaggatcaagcagtgc
accgtggtgaacatggacgacctcatcacagttcatcacgagatgggccacgtgcagtac
ttcctgcagtacaaggaccagcctgtctccttccgtgatggggccaaccctggcttccat
gaggctgttggggatgtcatggccttgtctgtctccacccccaaacacctgcatagcatc
aatctgctggaccaagtcatggaaaatgaagaaagcgatattaactacctgatgagcatc
gccctggataaaatcgccttcctgccctttgggtacctcatggaccagtggcggtggaag
gtgtttgatgggcggatcaaggacgatgagtacaacaaggagtggtggaacctcaggatg
aagtaccagggcttgtgcccaccagcactgaggtctgaagatgactttgaccctggggca
aagtttcatatccctgccaacgtcccttacattaggtacttcgtcagctttgtgatccag
ttccagttccaccaggcactctgtgatgcagctgggcacaagggtcccctccacacctgt
gacatctaccagtcccaggaggctgggaagatcttgggggatgccctgaagctgggtttc
agcaagccgtggcccgaagccatgcagctcatcacagggcagcccaacatgtcagcagag
gcccttatgagctacttcgagccactcatgacatggctggagaaagagaacaagaagaac
ggggaggtcctgggctggcccgagtacagctggactccttacacagcccaagatgactcc
agcaaaactgatttcctgggaatgttcctgaccaaaagtcaagccacagcaggtggctgg
gtcctgctcgccctggcactcatcttcctgctcaccaccatcttcttgggtgtcaagttc
ttctcagccaggagaaaggccttcaaatctagctccgaaatggaactgaaataa

DBGET integrated database retrieval system