KEGG   Parus major (Great Tit): 107215411Help
Entry
107215411         CDS       T04864                                 

Gene name
SETD2
Definition
(RefSeq) histone-lysine N-methyltransferase SETD2
  KO
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
pmaj  Parus major (Great Tit)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    107215411 (SETD2)
Enzymes [BR:pmaj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107215411 (SETD2)
Chromosome [BR:pmaj03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107215411 (SETD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
2
AA seq 2543 aa AA seqDB search
MGDFYDPEHPTPEEEENEGKPEAVPRAGFIKGPVFKGVASSRFLPKGTKTKVNLEEQGRQ
KVSFSISLTKKTLPNRFLAALGNEKQNETPSPPAVPLLADFNPKNKLDLGDAASSAEESS
PPKPKVELGKIHFKKHLLNVTAKPPPAPAAPLPAPPTEPVALAVDFPPTPPPPPPPPPPP
ASPMPVPGATAPPPPPPPPPVTPMPALLLSPPGEAEAPVPREPSHALPREATELDAKRDP
APRGSEERVAQTAPERTEITPPKEDSHIGKEDEVSDGSKGASACSRRQGAKRKFSQSDGA
LQGSESDEDSVRTSSSQRSHEQKISSTEKERDPRRSSTSLRGDDLGKSSSRSRSDRDEKY
SSYSKSERDSRYSSSRSRSDRERRRSRSHSRSRSDRSSRTSSSYSRSERSHYYDSDRRYH
RSSPYRERSRYSRSYADSRARESSDSEDEYRRTHSRSSDSRRTSSHSSSSYRDSRSSYSK
SDRDSKAESSHADVDRRGRSSSKADRDSKRTSESEVSKRCSPLDELGYRKGTSHSKPDSN
VNSSRYKSTPSKAPAPKPDKFKSSFCCTESIEEIKSKSNSLDLETSCVKNNEIRVSSVKK
LEREKTLSPLNQFSDSPALLKADESKAALANSKSEELVANEGHDSVKEQETFLKAKHDPL
RTCFPMESSVNGSPEGQDEGLATSSASRAEDVAASSDHGPGRSEASPAIKTSPSHLLPSN
GFESTDVPQEQEPDDSRVQSSECNSLFQEAEAPQPPEEAAPLPVVNVDPTQAVLKKSDEE
VTPCDKTKEPVFCYISDDATPGLYHSEVEIEAEPADLKVTSETFLDVQVEPQTVTCDYES
MEDSHSKSAGEDEHGHPSHKISLAVESSSRDSSQDGCSQRFQSDHPVPEESVSSKWDVPP
PGVCQEPLQHSEAEEMLESDAQHVDLGSAKGKLLFQNEHSYYSEVPLERRGREVVDEGAV
STEGAELDELRVQCPGVSAERDEGNEPLVASAFPDALYPSSDVIVTAEDVEMVSQAPTCD
SSGNASEFIPAGHDDYSDMGDSDSEGGSEESETEDSDSDDGTPRKRLQSVVVVPKNSTIA
TEENSPGSSRSSRRFSDHWDDERPEPSRPYYEERSENAGSKGGAQVESRCSPRGMEKSPA
TSTELSRKEPEELRADPCQAQSDGVDSTSQADLTADCHGKGSAEERTALPDAAAVGRPVG
RPEEQPFCVPESLESTDASRHQTSSSKPDSRQGQGGLNQSGLGDYSRLDGFRAPEDTGVV
GWDFSQQEKPSSTYQQPDSSFGMYSGYVYPPGSGAYPSSQSYWQGNGYWDARADSRASVG
SYERIQGQVPDSLTEDHEEYEEDERWDEDCKPSFPSPSGKSQMPGQKEKGSVQAHEISSN
STKEPLPGGEKKEEVKTLEKNEVKERGPPKKRRPELESDSESDGDSGEKRKAKLEGEQAE
AAPQDSSMVGRLCIMDDFRDPQRWKEFAKQGKMPCYFDLIEENVYLTERKKNKSHRDIKR
MLCECPPLSKEERAQGEVACGEDCLNRLLMIECSSRCPNGDYCSNRRFQKKQHADVEVIL
TEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIID
ATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQ
KCFCGSSNCRGYLGGENRVSIRAAGGKMKKERSRKKDSVDGELEALLENGEGLSDKNQVL
SLSRLMVRIETLEQKLTCLKLIQNTHSQSCLKSFLECHGLSLLWIWMTELGDGRGSTANN
LKLQLEIMKTLELLPIPTKNMLEESKVLPIIQRWAQTKTAVPQLSEGDGYSSENTSRAHT
PLNTPELSAKQSAEGDTDTPKKLVFRRLKIISENSMDSAISDTTSELEGKEGKEDLDQLE
AAPMEVPEEQQQQQQQQQQQQDIKSAVEAPAESSKSQPAELEAEPEAEVKESNGAKLEEP
MAMETPSQDEEEGVSDVESERSQEQTDKMVDVSDLATRLLDSWKELKEVYRIPKKSQAEK
ENSADRGRETAGLRDQTPTPKNPILSRERDPERQSQSKERKRRRDSLSPPSSAYERGTKR
PEDRYDTPASSKKKVRPKDRNKLSTEERRKLFEQEVAQREAQKQQQQLQNLGMTSPLPYD
SMGYGTPHHSFMGYPPGYPMQAYVDPSNPNAGKVLLPTPSMDSMCSPAGYEHSQTLAGPA
AEPALSAPQPVPVVQHVAAAAAAMEVTAPQYVAQSDAVVHQEPNVAVLPVAAAGAVQSQS
YGVWDSGQQPVAVQQPYSPAQSQPAIYYQGQTCQTVYGVTSPYSQTTPPIVQSYAQPGLQ
YIQGQQIYTAHPQGVIVQPPAAVTAIVAAGQPQPIQQPELVVTNNLLDLPPPSPPKPKTI
VLPPNWKTARDPEGKIYYYHVVTRQTQWDPPTWDSPGDEASLEHEAEMDLGTPTYDENPM
KSSKKPKTAEADTSSELAKKSKEVFRKEVRLTHGVMNKELKYCKNPEDLECNENVKHKTK
EYIKKYMQKFGILYKPKEDTELE
NT seq 7632 nt NT seq  +upstreamnt  +downstreamnt
atgggggatttctacgacccggagcaccccacgccggaagaagaagaaaatgagggcaaa
cctgaagcggtgccgagagctggttttatcaaaggtcctgtgttcaaaggcgtcgcctcg
agccgctttttgcccaaaggcaccaaaaccaaggttaaccttgaggagcagggaagacaa
aaagtgtctttcagcattagtttaaccaagaaaactttacccaatcgattcctggctgct
ctgggaaacgagaaacaaaatgaaactcccagccctccagcggttccccttctggctgat
tttaaccccaaaaataaactggacctgggggacgccgccagttcagccgaggaatcttca
cctccaaaaccgaaggtagaactggggaagattcattttaaaaaacatttactgaacgtc
acggcgaagccgcccccggctcccgcggcaccgctcccggcgccgccaacggaaccggtg
gccttggctgtggattttcccccgacgccgccgcctcccccgcccccgccgcccccgccg
gcgtcaccgatgccggttcccggagccacggcccctccgccgccgccaccgccgccaccg
gtgacaccgatgccggcgctgctgctgtcgccgcccggcgaagccgaagctcccgtgccg
agggagccgagccacgcgctgcccagggaggccacggagctggacgccaagcgggatccg
gcgccgcgcggctcggaggaacgcgtggctcaaaccgcgcccgagcggacggagataacc
ccgccgaaggaggattcccatattgggaaggaggatgaggtttccgacggctccaagggt
gcttccgcgtgctcccggaggcagggcgccaagaggaagttctcgcagtcggacggcgcg
ctgcagggctccgagtctgacgaggattctgtgaggacctcctccagccagcggtcgcac
gagcagaagatctccagcacggaaaaggagagagatcccagacggagctccacgtccctc
cggggcgatgacctgggcaagtcctcgtcgcgctccaggtcggacagggatgagaagtac
tcgagctattccaaatcggagagagactcgcggtactcgtcctcccgctcccgctcggac
agagagaggaggcggagccggtcccattcccgttcccgctccgatcgcagctccagaacc
agctcctcctactcgaggtcggagcgctcgcattactacgactccgaccgccggtaccac
cggagctcgccgtaccgggaacggtcgcggtattcccggtcgtacgcggacagccgcgcg
cgggagagctcggactcggaggatgagtacaggaggacacattccaggtccagcgactcc
aggcgtacgtcctcccattcctcctcctcctacagagactcgagatcctcctactccaag
tcggacagggacagcaaagcggagtcgtctcacgctgacgtggacaggcgggggaggtcg
tcttcgaaagcagatcgagattccaaaaggacttccgaaagtgaagtatccaaaaggtgc
tctcccctcgatgaactgggctatcggaaggggacatcccattccaagcccgacagtaat
gtgaattcctcccgctataaatccaccccttccaaggcccccgcaccaaagcctgataaa
tttaagagttctttctgttgtacagaatcgatcgaagaaatcaagtccaagtctaattct
ctagatttagagacctcttgtgtaaagaacaatgagatcagggtgtccagtgtgaaaaag
ttggaaagggaaaagacactttctccgttaaatcagttcagcgattctcccgctctgctg
aaggccgacgagtccaaggcggctttggcgaactcaaaatccgaggaacttgtagcaaac
gaaggccacgacagtgttaaggagcaagaaacgttcttgaaggcaaagcacgatccctta
agaacgtgtttccccatggaatcaagtgtgaacggctccccggagggtcaggatgagggt
ctggcaacttccagtgcctccagagcagaggatgtcgccgcgtcctctgaccacggcccg
ggccggtcggaagcgtcgccggccatcaagacgagcccgtcgcatctgttgccatccaat
gggtttgagagcacagatgtgccccaagagcaagagcccgatgattcccgggtccagtcc
agcgagtgcaacagcctgttccaggaagcggaggctccgcagccgccggaggaagccgcc
cctctccctgtcgtgaatgtagatcccactcaagctgtccttaagaagtcggatgaggag
gtgactccgtgtgacaaaaccaaagaacctgttttttgctacatttctgacgatgccacc
cctggtttgtaccactcggaagtagaaatagaagcggaacctgcggatttgaaagtgacg
tccgagactttcctggacgtgcaggtggagccgcagacagtgacatgtgactacgagagc
atggaggattcccattccaagtccgccggcgaggatgagcatggccatccttcccataaa
atcagcctggcagtggaaagctcgagcagggattcctcccaggatggctgttcccagagg
ttccagtcggatcatcccgtgccggaggaaagcgtctcttccaaatgggacgtgcccccg
ccgggtgtgtgccaggagccgctgcagcattcggaagccgaggagatgctggagtcggac
gctcagcacgtcgatcttggctcagcaaaaggcaaattgttgttccagaatgaacattcc
tactattcggaagtgccgctggagcgccgcggcagagaggttgtggatgaaggcgccgtt
tccaccgagggagccgagctggatgagctgagggttcagtgtcctggagtgtcggccgag
agggacgagggaaacgagcccttggtggcctcggcttttccagacgctttgtatccctcc
tccgacgtcatcgtcaccgcagaggacgtggagatggtgagccaagccccaacgtgcgac
agcagcggcaacgcctcggaattcattcccgccggccatgacgattattccgacatggga
gacagcgacagcgaggggggcagcgaggagagcgagacggaggactcggattccgatgat
gggacgccacggaagaggctccagtctgttgtggtggttcccaagaactccacaattgcc
acggaggagaacagcccgggctcctcccggagcagccggcgcttctccgaccactgggac
gatgagcggcccgagcccagcaggccctactacgaggagaggtcagaaaatgcggggagt
aaaggtggtgcccaggtggagagcaggtgctctcccagagggatggagaagagcccggca
acctccacagagctgagcaggaaggagccggaggagctgcgggcggatccgtgccaggcc
cagagcgacggcgtggacagcacgagccaggcggacctgacggccgattgccacggcaaa
ggcagcgcggaggagaggacagcgctgccggacgcggcggccgtgggaaggcccgtgggc
cggccggaggagcagcccttctgtgtcccggagagtttggagagcaccgacgcatcccga
caccagacgagctcttccaagcccgacagtcggcaagggcagggcgggctgaaccagtct
ggcctcggagactactccaggctggatggtttccgtgccccggaggacacaggggttgtg
ggctgggacttttcccagcaggagaagcccagcagcacctaccagcagccggacagcagc
ttcgggatgtactcgggctacgtttacccgccgggctccggagcctatcccagctcccag
agctactggcaaggcaacggttactgggacgcgagggcagacagcagagcctccgtgggc
agctacgaacgcatccaagggcaggtgccggattccctgacggaagaccacgaggagtat
gaagaggatgagcgttgggatgaggactgcaagcccagctttcccagcccctctggaaaa
tcccagatgcccgggcagaaggaaaaaggctcggtgcaggcacacgagatcagcagcaat
tccaccaaggagccgctgccgggcggggagaagaaggaggaggtgaaaaccttggaaaaa
aatgaggttaaagaaaggggcccaccaaaaaaaaggcgtccggagttggagagcgactca
gagagcgacggggactccggggagaagaggaaggcgaagctggagggggagcaggcggag
gcggcgccgcaggattcctccatggtgggcaggttgtgcatcatggacgacttcagggac
ccccagcgctggaaggagtttgccaagcaggggaagatgccctgttacttcgacctcatc
gaggagaacgtctacttgacagagaggaagaagaacaaatcccaccgggatatcaagcgg
atgctgtgcgagtgtcccccgctgtccaaggaggagcgggcgcagggcgaggtggcctgt
ggagaggattgtctcaaccgcctgctcatgattgaatgctcttcccggtgtccgaacggt
gactactgctccaaccggcgcttccagaagaagcagcacgcggatgtggaggtgatcctg
accgagaagaagggctgggggctcagagctgccaaggacctgccatccaacacttttgtc
ttggaatactgcggggaagtgctggatcacaaggaattcaaggctcgggtgaaggaatat
gcccggaacaagaacatccactattatttcatggccctgaagaacgatgagatcatcgat
gccacccagaagggaaactgctcccgtttcatgaaccacagctgcgagccaaactgtgag
acccagaagtggacggtgaatgggcagctgcgggtcggctttttcaccaccaagctggtc
ccgtcgggctcggagctgacctttgattaccaattccagagatacggcaaagaggctcag
aaatgtttctgtggctcctccaactgccgtggctacctgggtggggagaacagggtcagc
atccgcgccgccggcggcaagatgaagaaggaacgctcccggaaaaaggactcggtggat
ggggagctggaggcgctgctggagaacggggagggtctctccgataaaaaccaggtgctg
agcttgtcccgcctcatggtccgcatcgagaccctggagcagaaactcacctgcctcaaa
ctcatccagaacacgcactcgcagtcctgcctcaagtccttcctggagtgtcacggcttg
tccctgctctggatctggatgacggagctgggcgatggcagaggaagcaccgccaacaac
ctgaagctgcagctggagatcatgaagaccctggagctgctccccatccccaccaagaac
atgctggaggagagcaaggtgctgcccatcatccagcgctgggctcagaccaagacggcg
gtgccgcagctcagcgagggcgacggatattccagcgagaacacgtcccgggcccacacc
ccgctcaacaccccggagctctcggccaagcagagcgcggaaggtgacaccgacaccccc
aagaagttggtgttccggaggctgaagatcatcagtgagaacagcatggacagcgccatc
tcggacaccaccagcgagctggaagggaaggagggcaaggaggacctggaccagctggag
gcggccccgatggaggtgccggaggagcagcagcagcaacagcagcagcagcagcagcag
caggacatcaaaagcgctgtggaggcgccggcggagagcagcaaatcccaacctgcggag
ttggaggccgagcccgaggcagaggtcaaggagagcaatggagccaagctggaggagccc
atggccatggaaacgccgtcgcaggatgaagaggaaggagtttctgacgtggagagcgag
aggagccaggagcagacggataaaatggtggatgtgagcgacttggccaccaggctgctc
gacagctggaaggagctcaaggaggtttatcgcatcccgaagaagagccaagcagaaaag
gagaacagtgctgaccgtgggagagagacggccgggctccgggatcagacccccactccc
aagaatcccatcctgagccgagagcgggatccagagcggcagagccagagcaaggagagg
aagagacggagagattccctgtcccctccgtcctccgcctacgagcggggcacaaagagg
ccggaggacaggtacgacaccccagcatcatccaagaagaaagtgcggcccaaggaccgc
aacaagctgtccacggaggagcgccgcaagctcttcgagcaggaggtggcccaacgggaa
gcccagaaacaacaacagcagctccaaaacttgggaatgacttccccgcttccctacgac
tccatgggctacggaactccccaccacagcttcatgggataccctccgggctaccccatg
caggcctacgtggatcccagcaaccccaacgccggcaaggtgctgctgcccacgcccagc
atggactccatgtgttctccggcgggatacgagcattcccagactctggcggggccggcg
gcggagccggcgctgagcgccccgcagccggtgcccgtggtgcagcatgtggccgccgcc
gccgccgccatggaggtgacggcgccgcagtacgtggcgcagagcgacgccgtggtgcac
caggagcccaacgtggccgtgctgccggtggcggcggccggggcggtgcagagccagagt
tacggggtgtgggattccgggcagcagccggtggctgtccagcagccctactccccggca
cagtcccaacccgccatctactaccagggccagacctgccagaccgtctacggagtcacc
tcgccctactcgcagaccaccccgcccatcgtccagagctatgcccagccgggtctccag
tacatccagggccagcagatctacacagctcatccacagggagtcatcgtgcagcccccc
gccgccgtcaccgccatcgtggcggccgggcagccccagcccatccagcagccggagctg
gtggtcaccaacaacctcctggatctgcctccgccttcccctcccaaacccaaaaccatc
gtcctccctcccaactggaaaacggctcgggatcccgaggggaagatctactactaccac
gtggtcaccagacaaacccagtgggatcctcccacctgggacagccccggggacgaggcc
agcctggagcacgaggccgagatggacctcgggacccccacgtacgacgagaaccccatg
aagtcttccaagaagcccaagacggcggaagccgacacgtccagcgagctggccaagaaa
agcaaggaggtgttcaggaaagaggtgaggctgacccacggagtgatgaacaaggagctc
aagtactgcaagaaccccgaggacctggagtgcaacgagaacgtcaaacacaaaaccaag
gaatacatcaagaagtacatgcagaaattcgggatcctctacaagcccaaagaggacacg
gagctggaataa

DBGET integrated database retrieval system