KEGG   Pseudomonas mandelii: OU5_1490Help
Entry
OU5_1490          CDS       T03626                                 

Definition
(GenBank) peptide synthase
Organism
pman  Pseudomonas mandelii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1687930..1700913)
Genome map
AA seq 4327 aa AA seqDB search
MTDAFELPSNLVQALQRRAALTPDRVALRFLAQTPEQAVVLSYRELDQRARTIAGALQAE
AEFGDRAVLLFPSGPDYVAAFFGCLYAGVIAVPAYPPESAKRHHQERLLSIINDAEPRLL
LTSAGLRDALQQIEGAPPLLCVDTLDGALAASWVAPNLAGDHIAFLQYTSGSTALPKGVQ
VSHGNLVANELLIRHGFGIDLNPDDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVLMSPAY
FLGRPLRWLEAISEYSGTISGGPDFAYRLCSERVSESALERLDLSGWRVAYSGSEPIRLD
TLDRFGEKFAVCGFTTDSFMASYGLAEATLFVAGTPRGRGIGNLRVDDQALAQNRAEPGE
GSAIMSCGISQPDHAVLIVDPVALNELADNAVGEVWAAGPSIAHGYWRNPEASAKTFIQH
NDRTWLRTGDLGFMRDGELFITGRLKDMLIVRGHNLYPQDIEQTVEREVEVVRKGRVAAF
AVTVDGQEGIGIAAEISRSVQKILPTDALIKAIRQAVAEAYQEAPSVVVLLNPGALPKTS
SGKLQRSACRNRLKDGSLDSYALFPSADVQGESGTASGCDLQALIGQIWSEQLQVKQVNA
DDHFFLLGGNSIAATQVVARLRETLGLELNLRLLFEAPTLGAFTADVAQLQQDGGLAQGV
ITPLSRHEPMPQSLAQNRLWITWQLDPHSSAYNIPGALRLRGELDENALRASFQQLIERH
ESLRTRFFERDGVALQQVDAAGEFNLQLIDISELPAEEREARALHIREDEARTQFDLEKG
PLLWVTLVRLDDDDHQLLVTMHHIIADGWSLNVLIDEFSRLYAAASQGQKATLPALPTQY
ADYGSWQRQWLAQGEGERQLAYWKTQLGEEHPTLNLATDHPRSAQHVHSAARHSIKLAAT
LSDAIRQTAQAHESTPFMLLLAAFQSLLHRYSGQRDIRIGVPNANRPRLETQGLIGFFIN
TQVLRADVDSRLPFVELLAQTRQAALGAQAHQDLPFEQLLEAFPQAREQGLFQVMFNHQQ
RDLNALRRLPGLLAEELPWHSREAKFDLQLHSEEDQKGRLSLSFDYASELFDATTIERLA
EHFSHLLRAICELPSTAIGDLPLLSANEHDQQSSWSAAPCTPASQWLPERLNEQARQTPE
RTALIWDGGSLDFAELHIQANRLAHYLRDKGVGPDVCVAIAAERSPQLLIGLLAIIKAGG
AYVPLDPDYPAERLAYMLSDSGVELLLTQTQLLERLPATDGVSFIAMDALHLENWPSQAP
GLHLHGDNLAYVIYTSGSTGQPKGVGNTHAALAERLQWMQNTYGLNDTDVLMQKAPISFD
VSVWECFWPLITGARLLIAGPGEHRDPHRIAQLVQQYGVTTLHFVPPLLSLFIDEPLTAE
CTSLRRVFSGGEALPAELRNRVLEQLPAVQLHNRYGPTETAINVTHWHCVRADGERSPIG
RPLGNVVCRVLDSDLNPVPAGVPGELCISGIGLARGYLGRPGLTAERFVVDPLGEQGARL
YRTGDRARWTADGVIEYLGRLDQQVKLRGFRVEPEEIEARLLAQEGVAQAVVLVRETVAG
GQLIGYYTATDSIEQVDVQTARLKAALAAELPEYMVPAQLMRLDEMPLSPSGKLDRRALP
EPQWQVREHVEPVTALEQQIAGIWREVLGLGQIGLRDDFFALGGHSLLATQIISRTRQAC
DVELPLRALFENSELGAFAEQVQLIQASGKTNQQPPIENVDRRQPVPLSYSQQRMWFLWQ
MEPDSPAYNVGGMARLRGVLDVGRFEAALQALIMRHETLRTTFPSIDGVARQQVHAQTGM
RMDWKDFSALEADSREQRVQQLADDEAHKPFDLETGPLLRACLVKTAEHEHYLVLTLHHI
VTEGWAMDIFARELSALYEAFVDDRESPLAPLPVQYLDYSVWQRQWLESGERQRQLDYWT
AQLGREHPLLELPADRPRPPVQSHQGELFRFDLSDDLAARVRAFNAQNGLTLFMTMTAAL
AVLLYRYSGQNDLRIGAPVANRIRPESEGLIGAFLNTQVLRCQLDGQMSVGELFEQVRHT
VIEGQSHQDLPFDHLVEALQPPRSAAYNPLFQVMCNVQRWEFQQSRTLAGMTVEYLANDA
RATKFDLNLEVTDLDHRLGCCLTYSTDLFDEPRIARMAGHWRNLLEALLSDPQQRLCELP
LLEATEQQKLLDSLGVEPGEHRLDQCIHHLFSEQALARKDAPALTFAGETLSYAELDSRA
NRLAWMLRERGVGPQVRVGLALERSLEMVVGLLAILKAGGAYVPLDPEYPLDRLHYMIED
SGIGLLLSDAAMFDALGELPASVGRWCLEEDAAALAHYPATELPFISLPQHQAYLIYTSG
STGKPKGVVVSHGEIAMHCQAVIERFGMRPDDCELHFYSINFDAATERLLVPLLSGAHVV
LRAQGQWDAEDICGLIRRHHINILGFTPSYGSQLAQWLATQGEILPVRMCITGGEALTGE
HLTRIRAAFKPSLFFNAYGPTETVVMPLASLAPEQLEEGLASVPIGSVIGARVAYILDAD
LALVPQGATGELFVGGAGLAQGYHQRPGMTAERFVADPFAADGGRLYRTGDLVRQRADGL
VEYLGRIDHQVKIRGFRIELGEIETRLLEHESVREAVVLALDAPSGKQLVGYLVTEVAEQ
EETQQAALREALKHHLKSQLPDYMVPTHLILLASMPLTTNGKLDRRALPAPDPELNRQHY
VAPSNELELTLTGIWCEVLNVEQVGLNDNFFELGGDSILSIQVVSRARQQGIHFSPRDLF
QHQTVQTLAAVATRTEQVTAEQGLLSGESRLTPIQHWFFDTDIPQRQHWNQALLLEPTDA
LEPHRLEQALLAVIEQHDALRLRFSQTDTQWRAEHQVISNVPVLWQVRVSSMDKCAALFA
DAQRSLDLEQGPLMRVLLVDGPEGVQRLFIAIHHLVVDGVSWRVLLDDLQTVYRQLDAGQ
SVKLSAKTSAFKDWSTRLQAYAGSESLREELSWWQSQLTGPNAELPCNRPEGGRQNRHAQ
TVSVRLDAERTLQLLQQAPSAYRTQVNDLLLTALARVLCNWSGEESALIQLEGHGREALF
DEIDLTRTVGWFTSAYPLRLMPADGQGASIKAIKEQLRAVPHKGLGYGVLRYLADDLSRQ
TLAALPVAPITFNYLGQFDQSFGADALFRPLDEPVGAAHDPQAPLPNELSVDSQVYGGEL
LLRWTFSAERHDPQAITDLANAYLGELQSLIEHCLRDDAGGLTPSDFPLAKLTQPQIDAL
PIPAAVIEDVYPLTPMQEGMLLHTLLEPGTGLYYMQDRYRINSELDPQRFAQAWQAVIAR
HEALRASFCWNVGEDMLQVIHKPGSTPIEILDWTQIAEAEQEPKLQALLKSEREAGFDLL
NQAPFHLRLIKVGAARYWFIMSNHHILIDAWCRSLLMNDFFEIYTALGEGRDAQLTVPPR
YRDYIGWLQRQSLAEARQWWKTNLQGFERTTPIPSDRPFLREHAGESGGMIVGDRYTRLD
ARDGAQLRELAQAHQLTINTFAQAAWALVLRRLSGDRDVLFGVTVAGRPVDMPQMQRTVG
LFINSIALRLKMPEDDQRCSVRQWLSGLLDSNMQLREYEYLPLVSIQENSELPKGQPLFD
SLFVFENAPVEVSVLDRAQSLNATSDSGRTHTNFPLTAVCYPGDDLGLHLSYDQRYFDES
TVERMLGEFKRLLLALVEGFHGDMADLPLLGDEEQDFLIHGCNQSEHDYPLEQSYVALFE
AQVARHPQRIAASCLDQQHSYVELNRRSNRLGHALIAAGVGLDQPVALLAERNLDLLGMI
IGSFKAGAGYLPLDPGLPSQRLSRIIDLSRTPLLVCTQTCREQAVALLEAFSCANRPKLL
VWEEVQASDVSVANPGVYSGPDNLAYVIYTSGSTGLPKGVMVEQRGMLNNQLSKVPYLNL
SEVDVIAQTASQSFDISVWQFLAAPLFGARVDIVPNTIAHDPQGLLAHVSAQGITVLESV
PSLIQGMLAQERMSLDGLRWMLPTGEAMPPELAHQWLLRYPEIGLVNAYGPAECSDDVAF
FRVDMASTRGSYLPIGTPTDNNRLYLLDGALDLVPLGAVGELCVAGTGVGRGYVSDPLRT
ALVFVPNPFGAPGDRLYRTGDLARRRSDGVLEYVGRIDHQVKIRGYRIELGEIEARLHEQ
PEVREAAVGVQEGVNGKHLVGYLVAADALIKPTERLERIKQRLRTELPEYMVPLHWLWLE
RMPLNANGKLDRKALPALEIGQLQSQDYQAPRTELEQTLANIWAEVLKVEKVGAQDNFFE
LGGHSLLATQIASRVQKALQRDVPLRAMFECSTVAELAEYINGLAASDITEEKVDRLNDL
MAELEGF
NT seq 12984 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgcgttcgaactcccaagcaatctggtccaagccctccagcgccgagcggcc
ctgacgccggatcgggtggccttgcgttttctcgcccaaaccccggagcaggccgtggtc
ctcagttatcgcgagctggatcagcgggcgcgaaccattgccggtgcgttgcaggccgag
gctgagttcggcgatcgcgccgtgctgttgtttccgagcggcccggattacgtcgcggcg
ttttttggttgcctgtacgccggggtgatcgcggtgccggcttatccgccggagtcggct
aaacgtcatcaccaggaacgtttgctgtcgatcatcaacgatgccgagccgcgcctgctg
ctgaccagcgccggcctgcgtgacgccttgcagcagattgaaggtgcgccgccgctgctg
tgcgtcgacaccctcgacggtgccttggccgccagctgggtcgcgccgaacctggccggt
gaccacatcgcctttctgcaatacacctccggttccaccgcgttgcccaaaggcgtgcaa
gtcagccacggcaacctggtggccaatgaactgctgatccgtcatggcttcggtatcgat
ctgaacccggatgacgtgatcgtcagctggctgccgctgtaccacgacatgggcctgatc
ggcggtctgttgcagccgattttcagcggtgtgccgtgtgtgttgatgtcaccggcgtac
ttcctcggccggccgttgcgctggctggaagcgatcagcgaatacagcggcaccatcagc
ggcggcccggatttcgcctatcgcctgtgcagcgagcgcgtcagtgagtcggcgctggaa
cgcctcgacctgagcggctggcgcgtcgcgtattccggctccgaaccgattcgtctcgac
accctcgatcgtttcggcgaaaagttcgcggtgtgcggtttcactactgacagtttcatg
gcgtcctacgggttggccgaagccaccttgtttgtcgccggaaccccgcgcggtcggggc
atcggcaacctgcgcgtggacgatcaagccctggcccaaaaccgcgcagagcctggcgag
ggcagcgcgatcatgagttgcggcatcagtcagccggatcacgcggtgttgattgtcgac
ccggtcgcgctcaacgaactcgccgacaacgccgtcggcgaagtgtgggctgccgggcct
agcatcgcccatggctactggcgcaaccccgaggccagcgccaagaccttcatccagcac
aacgaccggacctggctgcgcacgggcgacctgggtttcatgcgtgacggtgaactgttc
atcaccgggcgcctgaaagacatgctgatcgttcgcggtcacaacctgtacccgcaagac
atcgaacagaccgtcgaacgcgaagtggaagtggtgcgcaaaggtcgtgtcgcggccttc
gcggtcactgtcgatggccaggaaggcatcggcatcgccgcggaaatcagccgcagcgtg
cagaaaatcctcccgaccgacgcgttgatcaaagccatccgccaagcggtggccgaggcg
tatcaggaagcgccgagcgtggtggtgctgctcaatccgggcgcattgcccaaaacctcc
agcggcaaactgcaacgttcggcctgccgcaatcgtctgaaggacggcagtctcgacagc
tatgcgctgttcccttcagcggacgttcagggcgaatccggcacagcgtcgggttgcgac
ctgcaagccttgatcggccagatctggagtgagcaactgcaggtcaaacaggttaacgcc
gacgatcacttcttcctgctcggcggcaattccatcgccgccactcaagtggttgcgcga
ctgcgtgaaacactcggactggagctgaacctgcgcctgctgttcgaagcgccaaccctc
ggcgccttcactgccgatgtcgctcagctgcaacaggacggcggcctggcccaaggcgtg
attactccgctgtcgcgtcacgaaccgatgccacagtctctggcgcaaaaccgcctctgg
attacctggcaactcgatccgcacagcagcgcctacaacattcccggagccttgcgcctg
cgtggcgagctggacgaaaacgccttgcgcgccagtttccagcagctgatcgaacgtcat
gaatccttgcgcacacgcttcttcgaacgggacggcgtggcgctccagcaggtcgatgcg
gcgggcgaattcaacctgcaattgatcgacatcagcgaactgcccgccgaggagcgcgaa
gcccgcgcgctgcacatccgtgaggacgaagcccgcacccaattcgatctggagaaaggc
ccgctgctgtgggtgacgctggtgcgcctcgacgacgatgaccatcaactgctggtgacg
atgcatcacatcattgccgatggctggtcgctgaacgtgctgatcgacgagttctcgcgc
ctttacgccgcggcttcccagggacaaaaggccacgcttcccgcattgccgacccaatac
gccgattacggcagctggcagcgtcaatggctggcgcaaggggagggcgagcgtcaactc
gcctactggaaaacgcagttgggcgaagagcatccaacgctgaacctggccaccgatcat
ccgcgctcggcgcagcacgttcacagtgctgcccgccactcgataaagctcgccgcgacc
ctgagcgatgccattcgccagaccgcccaggcgcatgagtcgacgccgttcatgctgttg
ctcgccgccttccagagcctgttgcaccgctacagcggccagcgcgacatccgcatcggc
gtgccgaatgccaaccgcccgcgcctggaaacccaagggctgatcggcttcttcatcaac
acccaggtgctgcgtgccgacgtggattcgcgcctgccattcgttgagctgctggcgcaa
acccgccaggccgcgctgggggcgcaagcgcatcaggatctgccgttcgaacaactgctc
gaagcgttcccgcaagcgcgcgaacaaggcttgttccaggtgatgttcaaccaccagcaa
cgggacttgaacgcgctgcgccgcctgccgggattgctcgccgaagaactgccgtggcac
agccgcgaagccaagttcgacctgcaactgcacagcgaagaagaccagaagggtcgcttg
agcctgtccttcgactacgccagcgagctgttcgacgcgacgaccatcgagcgcctggcc
gagcatttcagccacctgctgcgagccatttgcgagctaccgtccaccgccatcggcgac
ctgccactgctgagcgcaaacgaacacgaccaacaatcgtcctggagcgccgcgccgtgc
acaccggccagccaatggttgccggaacggctcaacgagcaagcgcgccagaccccggaa
cgcaccgcgctgatctgggacggcggcagcctcgatttcgccgaactgcacatccaggcc
aaccgcctggcccattacctgcgcgacaaaggcgtcggtccggacgtctgcgtggccatc
gccgccgagcgttcgccgcagttgctgatcggcctgctggcgatcatcaaggctggtggt
gcctatgtgccgctggacccggattacccggccgagcgcctggcctacatgctcagcgac
agcggtgtggagttgctgctaactcagacccaattgctcgaacgcctgccggccaccgat
ggcgtcagcttcatcgccatggatgcgctgcatctggagaactggccaagccaggcgccg
ggcctgcaccttcacggcgacaacctcgcctacgtgatttacacctcaggttccaccggt
caacccaagggcgtcggcaacacccacgcggcgctcgccgagcgcctgcaatggatgcag
aacacctacgggttgaacgacaccgacgtgctgatgcagaaagccccgatcagtttcgac
gtgtcggtgtgggagtgcttctggccgctgatcaccggcgcccgcttgctgattgccggt
cccggcgagcaccgcgatccgcatcgcatcgcgcagctggttcagcaatacggcgtgacc
acgctgcacttcgtgccgccactgctttcgttgttcatcgacgagccgctgaccgccgaa
tgcaccagcctgcgccgggtcttctccggtggcgaagccttacccgccgagctgcgcaac
cgcgtgctggaacaactgccggccgtgcaattgcacaaccgctacgggccgaccgaaacc
gcaatcaacgtcacccattggcactgcgtccgcgccgatggcgagcgctcgccgattggc
cgtccgttgggcaacgtggtgtgccgcgtgctcgacagcgacctcaacccggtgccggcc
ggggtgccgggtgagctgtgcatcagcggcatcggccttgctcggggttatctgggccgt
ccgggactgaccgctgaacgttttgtcgtcgatccactgggcgagcagggcgcgcgtctg
taccgcaccggcgaccgtgcgcgctggacggcggatggggtgatcgaatacctcggtcgc
ctcgatcagcaggtcaaactgcgcggcttccgtgtcgagcccgaagaaatcgaagcgcgc
ttgctggcccaggaaggtgtcgcccaagccgtggtgctggtgcgcgaaacggtcgccggt
ggccaattgatcggttactacaccgccaccgattccattgaacaggttgatgttcaaacc
gcacgcctgaaagccgcactggcggctgagctgccggaatacatggtcccggcgcagctg
atgcgcctggacgaaatgcccctgagcccgagcggcaaactcgaccgtcgtgccttgccc
gaaccgcaatggcaagtgcgcgaacacgtcgagccggtcacagcgcttgagcagcaaatc
gccggcatctggcgcgaagtgctcggccttgggcagattggcctgcgtgacgatttcttc
gccctcggcggtcattcgttgctggccacgcaaatcatttcccgcacccgtcaggcctgc
gacgttgagttgccgctgcgggcactgttcgaaaacagtgagctgggcgcgtttgccgaa
caggtgcaactgatccaggccagcggcaagaccaaccagcaaccgcccatcgagaacgtc
gaccgccgccaaccggtgccgctctcttattcccagcaacgcatgtggtttctctggcaa
atggagccggacagcccggcctataacgtcggcggcatggcacggttgcgcggtgtactc
gatgtcgggcgtttcgaagcggcgttgcaagcgctgatcatgcgccacgaaaccctgcgc
accacgttcccgagcatcgacggtgtggcccgccaacaggtgcatgcgcaaaccggcatg
cgcatggactggaaggacttctcggcgctggaggccgacagccgtgagcaacgggtgcag
caactggctgacgacgaggcacataaaccgttcgatctggaaaccggtccgctgctgcgc
gcctgtctggtcaagaccgccgagcacgaacactatctggtgctgactttgcaccacatc
gtcaccgaaggctgggcgatggacatctttgcccgggaactgagcgcgctgtacgaagcg
ttcgtcgatgaccgcgaatcgccgttggcaccgctgccagtgcagtacctggattacagc
gtctggcagcgccagtggctggaatccggcgagcgccagcgccagctcgactactggacc
gcgcaactgggccgcgaacatccgctgctggaattgcccgccgaccgtccacgtccgccg
gtgcaaagccatcagggcgaactgttccgtttcgacctgagcgatgacctcgccgcacgg
gtacgcgccttcaacgcgcaaaacggcctgaccctgttcatgaccatgacagccgcactg
gccgtgctgctttatcgctacagcggccaaaacgacctgcgcatcggcgcgccggtggcc
aaccggattcgcccggaaagcgaaggactgatcggggcgttcctcaacacccaagtgctg
cgttgccagctcgacgggcagatgtccgtcggtgaattgttcgagcaggtgcgccacacg
gtgatcgaaggccagtcccatcaggacttgccattcgatcacttggttgaggccttgcag
ccaccgcgcagtgccgcgtacaacccgctgttccaggtgatgtgcaacgtgcaacgctgg
gaattccagcaaagccgcaccctggccggcatgaccgtcgagtacctggccaacgatgcc
cgggcgaccaagttcgacctcaacctggaagtcaccgacctcgatcatcgactgggttgc
tgcctgacttacagcaccgatttgttcgatgaaccgcgcattgcacgcatggccgggcac
tggcgcaatctgctggaagcgctgctgagcgatccgcaacagcgactctgcgagttgccg
ttgctcgaagccacggaacagcaaaagctgttggacagccttggcgtcgaaccgggcgag
catcgcctcgatcaatgcatccatcacctgttcagcgagcaagccctcgcccgcaaagac
gcaccggcgttgacgtttgcaggtgaaaccctgagctacgccgaactcgacagccgcgcc
aatcgcctggcctggatgcttcgcgaacgcggtgtcggcccgcaggttcgcgtcggcctg
gcgcttgagcgttcgctggaaatggtcgtcggcctgctggcgatcctcaaggccggcggc
gcttatgtgccgctggacccggaatacccgctcgatcgcctgcattacatgatcgaggac
agcggcatcggtttgctgctcagcgatgcggcgatgttcgacgcgctcggcgaattgccg
gccagcgtcggccgttggtgcctcgaagaggacgccgccgcgttggcccattacccggcc
accgaactgccctttatcagcctgccgcaacatcaggcgtacctgatttacacctcgggt
tcgaccggcaaaccgaaaggtgtggtggtgtcccacggtgaaatcgccatgcattgccaa
gcggtcattgagcgcttcggcatgcgcccggacgattgcgaactgcatttctattcgatc
aacttcgacgccgcgaccgagcgtttgctggtgccgttgttgagtggtgcgcacgttgtc
ctgcgcgcccaaggccaatgggacgcggaagacatctgcgggctcattcgtcgccaccac
atcaacatcctcggcttcaccccaagctacggcagccaattggcgcagtggctggcgacc
cagggcgaaatcctcccggtgcgcatgtgcatcaccggcggcgaagccctgaccggtgaa
cacctgacgcgaatccgtgcggcgttcaaaccaagcctgtttttcaacgcctacggcccg
accgaaaccgtggtcatgccattggccagtctcgcacccgaacagctggaagaaggcttg
gccagcgtgccgatcggcagcgtgatcggcgcgcgggtcgcctacatcctcgatgccgac
ctggccttggtaccgcaaggcgcgaccggtgagttgttcgtcggtggcgccggtctggcg
cagggttatcaccagcgaccgggcatgaccgccgaacggtttgtggcggatccattcgcc
gccgatggcggacgtctgtaccgcaccggcgacctggtgcgccagcgtgccgatggcctg
gtggagtatctggggcgcatcgaccatcaagtgaagattcgcgggttccgcatcgagttg
ggcgagatcgaaacccgtctgctggagcatgagtcggtccgcgaagccgtggtcctggcc
ctcgacgcgccgagtggcaaacagctggtcggctatctggtgaccgaagtcgccgagcag
gaggaaacgcaacaagcggcattgcgtgaagcgctgaagcatcacctcaaatcgcaactg
ccggattacatggtgccgacgcacctgatcctgctggccagcatgccgctgaccaccaat
ggcaaactcgaccgccgcgccttgccagcgccggacccggaactcaaccgtcaacactac
gtggcgccaagcaacgagctagagctgaccttgaccggcatctggtgcgaggtgctgaac
gtcgagcaagtgggccttaacgacaacttcttcgaactgggcggcgattcgattctgtca
atccaggtggtcagccgtgcgcggcagcagggcattcatttcagtccgcgtgacctgttc
cagcaccagaccgtgcaaaccctggccgccgtggccacccgcaccgagcaggtcaccgcc
gagcaaggcctgctcagcggtgagtcgcgtctgacgccgattcagcactggttcttcgac
actgacattccccagcgtcagcactggaaccaggcattgctgctggagccgactgacgcg
ctggaaccccatcgcctggagcaagcgctgctggcggtaatcgaacagcacgatgccttg
cggttgcgtttcagccagaccgacacgcaatggcgcgccgagcatcaggtgatttccaac
gtgccggtgctgtggcaagtgcgagtttcgtccatggacaaatgcgccgcgctgttcgcc
gatgcccagcgcagcctcgacctcgaacaggggccgctgatgcgcgtgttgctggtcgat
ggtcccgagggcgtacaacggctgttcatcgccattcaccacttggtggtggacggcgtt
tcgtggcgggtgctgctcgacgatctgcaaaccgtttaccgtcaactggacgccgggcag
tcggtcaaactgtcggcgaaaaccagcgctttcaaggattggtccacccgtttgcaggcc
tatgccggcagcgaatccctgcgtgaagaactgagctggtggcagtcgcaactgaccggg
ccgaatgccgaattgccctgtaatcgtcctgagggcgggcggcagaaccggcatgcgcaa
accgtcagcgtgcgcctcgatgccgagcgtactctccagttgctgcaacaggcgccgagt
gcctatcgcacgcaggtcaacgacctgctgctgaccgcgttggctcgggtgctgtgcaat
tggagcggagaggagtcggcgctgattcagcttgaaggccacggccgcgaagccctgttc
gacgagatcgacctgacccgcaccgtcggctggttcaccagcgcttatccgttacgcctt
atgccggcggacgggcagggcgcctcgatcaaggcgatcaaggaacaactgcgtgccgtg
ccgcacaaaggcctgggttatggcgtactgcgttatctggccgatgatctgagtcgtcag
accctggccgcgttgccggtggcgccgatcaccttcaactacctcggtcagttcgaccag
agcttcggcgcggacgccttgttccgtccgctggacgagcccgtcggcgcggcccacgat
ccgcaggcgccgctgcccaatgagctgagcgtcgacagtcaggtgtatggcggtgagctg
ttgctgcgctggactttcagcgccgaacgccacgatccgcaagccatcaccgacctggcc
aacgcttatcttggcgaactgcaaagcctgatcgaacattgcctgcgcgacgatgcggga
ggcctgacgccgtcggacttcccgttggcgaaactgacccagccgcaaatcgacgcgttg
ccaatcccggccgccgtcatcgaagacgtctacccgctgaccccgatgcaggaaggcatg
ctgctgcacaccttgctggaaccgggcaccggcctctactacatgcaggaccgctaccgc
atcaacagcgaactcgacccgcaacgtttcgcccaggcctggcaagcggtgatcgcccgc
cacgaagccctgcgcgcatcgttctgctggaacgttggcgaagacatgctgcaagtgatc
cacaaacccggcagcacgccgatcgagatcctcgactggacgcaaattgccgaagccgag
caagagccgaaactgcaagcgctgctcaaaagcgagcgtgaagccgggttcgatctgctc
aatcaggcacctttccacctgcgcttgatcaaggtcggcgcggcgcgttactggttcatt
atgagcaaccaccacatcctgattgatgcctggtgccgctcgctgctgatgaacgatttc
ttcgaaatctacaccgccctcggcgaaggccgggacgcgcaactgaccgtgcccccgcgt
tatcgcgactacattggctggctgcaacgccagagcctggccgaggcgcggcagtggtgg
aaaaccaatctgcaaggtttcgaacggaccacgccgatcccgagcgaccggccgttcctg
cgtgagcatgccggtgaaagcggcggcatgatcgtcggtgaccgctacacaaggcttgat
gctcgtgacggtgcgcaactgcgcgaactggcgcaggcgcatcaactgaccatcaacacc
tttgcgcaagcggcgtgggccttggtgctacgacgtttgagcggtgatcgtgacgtgctg
ttcggcgtcacggtggccgggcgtccggtggacatgccgcagatgcagcgcaccgtcggg
ctgttcatcaacagcatcgcgctgcggttgaaaatgcccgaggacgatcagcgttgcagt
gtgcgccagtggttgagtggtttgctcgacagcaacatgcaactgcgcgagtacgaatac
ctgccgctggtgagcattcaggaaaacagcgaactgcccaagggccaaccgctgttcgac
agcctgttcgtgttcgaaaacgccccggtggaagtctcggtgctggaccgtgcacagagc
ctcaatgccacgtccgattcgggccgcacccacaccaacttcccgctgacggcggtctgc
tatccgggggatgacctggggctgcacctgtcttacgaccagcgttatttcgacgaatcg
accgtcgagcgcatgctcggcgagttcaagcgattgttgctggcgctggtcgaaggcttc
catggcgacatggccgatctgccgttgctgggcgacgaggaacaggatttcctgatccac
ggctgcaaccagagcgagcacgattacccgctggaacaaagctatgtcgcgttgttcgaa
gcgcaggtcgctcggcatccgcagcggattgccgcgagttgcctggatcagcaacacagt
tatgtcgaactgaaccggcgcagcaaccgtctcggtcatgcgttgatcgcggccggggtc
gggctggatcaaccggtggcattgctggccgaacgtaacctcgatctgctcggcatgatc
atcggcagcttcaaggcgggcgcgggttatctgccgctggacccggggctcccgagtcag
cgtctgagccggatcatcgacctgagccgcacgccattgctggtctgcacgcaaacctgt
cgtgaacaggcggtcgcgctgctggaggcgttcagttgcgccaaccggccgaaattactg
gtctgggaagaggtgcaggcgagcgatgtatcggtggcgaatccgggtgtttacagcggc
ccggacaacctcgcctatgtgatctacacctccggctccaccggtttgcccaaaggcgtg
atggtcgaacagcgcggcatgctcaacaaccagttgagcaaggtgccgtacctgaatctc
agcgaggttgatgtgatcgcccagaccgcttcgcaaagcttcgacatttcggtctggcag
ttcctcgccgcaccgctgttcggggcgcgggtggacattgtgccgaacaccatcgcccat
gacccgcaagggttgctggcgcacgtatcggcccagggcattacggtactggaaagcgta
ccgtcgctgattcagggcatgctcgcccaggaacgcatgagcctcgacggcctgcgctgg
atgctgccgaccggtgaagcgatgccgccggaactggcgcatcaatggctgctgcgctac
ccggagatcgggctagtgaatgcctatggcccggcggaatgctcggacgacgtggcgttc
ttccgcgttgacatggcctcgacccgaggcagttacctgcccatcggtacgccgaccgac
aacaaccgtttgtacctgctcgatggcgcgctggacctggtgccgttgggtgcggtgggc
gagttgtgcgtcgccggcacgggggtcgggcgtggttacgtcagcgacccgttgcgcacc
gccctggtatttgtaccgaacccgtttggcgcgccgggggatcgtctgtatcgcaccggc
gacttggcccgacgtcgcagtgacggcgtgctggaatacgttgggcgtatcgaccatcaa
gtgaagattcgcggttaccgcatcgaactgggtgaaatcgaagcacgcctgcatgagcaa
ccggaagtgcgcgaagcggcggtcggtgtgcaggaaggcgtgaacggcaagcatctggtc
ggctatttggtcgcggcggatgctttgatcaagccaacggagcgactcgaacgcatcaag
caacgcctgcgtaccgaactcccggagtacatggtgccgctgcactggttgtggctggag
cggatgccgctcaatgccaacggcaaactcgaccgcaaggcgctgccggcgctggagatc
ggccagttgcagagccaggattaccaggcgccgcgcaccgagctggagcagaccctggcg
aatatctgggccgaggtgctgaaggtcgagaaggtcggcgcgcaggacaacttcttcgaa
ctgggcgggcattcgttgctggcgacgcagattgcttcgcgggtgcagaaagccttgcaa
cgggatgtgccgttgcgggcgatgttcgagtgcagcacggtggcggagttggccgagtac
atcaacgggttggcggcgagtgacatcaccgaggagaaggtggatcgcctcaatgacttg
atggcggagttggaggggttttga

DBGET integrated database retrieval system