KEGG   Pseudomonas mandelii: OU5_1604Help
Entry
OU5_1604          CDS       T03626                                 

Definition
(GenBank) acyl-CoA synthetase
  KO
K00666  
fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
pman  Pseudomonas mandelii
Brite
Enzymes [BR:pman01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     OU5_1604
Lipid biosynthesis proteins [BR:pman01004]
 Acyl-CoA synthetase
  Unknown
   OU5_1604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1830110..1831861)
Genome map
AA seq 583 aa AA seqDB search
MTVLYLSETSAVRSLPQRFADFSSLAEALDYAALGQTGMNFYDRRCHLVAVVEYRQLQAR
AVAAAKKLLGIGLRKGDRVALIADTTPCFVKAFFACQYAGLIPVPLPIPAGVGHHHAYVE
KLRGLLASCSPSAIVGGREWLPYVNEAVDASALKFTGDFDSVEALAMSDVKLVRPQPDDI
AYLQYTSGSTRFPQGVVVTQQSVMANLRGISLHGIRLQPHDRCISWLPYYHDMGLVGFVL
TPVATQLSVDYLQTRDFAMRPKQWLNLMSRNRGTVSVAPPFGYDLCVRRCSSAEVESLDL
SKWRVAGVGAEPIAISTLNRFAEHFAPAGFKASAFMPCYGLAENTLAVSFAAPGAGGQVD
RVDRDILELEGRAVKATEQSAAVSTFVNCGRPLPGHQLQVLDDTGHALAERCIGRIVISG
PSLMAGYFEDQESRQQLEVTRWLDTGDLGYLLDGDLYVTGRKKDLIIIRGRNIWPQDIEL
VAESEPEVRPGDAIVFIVQDNGETSVVVQVQCRIVAQEARERLLHTLFAKIHSEFGLSPM
IELVPPHSIPRTSSGKPARAEARKRFLSQLVVRQETFAVAGSA
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttctctatttgtcagagacaagcgctgtacgttcactgcctcaacgatttgca
gatttttcttcattggctgaagcgcttgactacgcggcgcttggccagacgggcatgaat
ttctacgaccgacgttgtcatctagtggccgttgttgagtacagacaattgcaggctcga
gccgtagccgcggccaagaagttattaggtattggtctgaggaagggagatcgtgtagca
ctcatcgcagacacgacaccctgcttcgttaaagctttttttgcatgtcaatacgcaggt
ctcattccggtgccactgcctattcccgcaggggtaggacaccatcatgcgtacgttgaa
aagctgcgaggattgctggccagttgctctccctcggcaattgtcggcggccgagagtgg
ttaccgtatgtgaatgaggctgtagatgcctccgcactgaaattcactggtgactttgat
tcggtcgaagcgctcgccatgtccgacgtcaaactcgtgcgtccgcaaccggatgatatt
gcctacctgcagtacacttcaggtagtacccgctttcctcagggcgtggtcgtaacgcag
cagtcagtaatggctaatcttcgaggcatcagtcttcatggaatcaggctacagccccac
gatcgttgcatttcgtggttgccgtactaccacgacatggggttggttggtttcgtcctg
actccggtcgccactcagctatcggttgactatctgcagacacgagatttcgccatgcgc
cccaagcaatggttgaatctgatgagtcgtaacagaggtacggtgtctgtcgcaccgcct
tttgggtacgacttgtgcgtacgacgctgcagttctgcagaggtcgaaagccttgatctt
tcgaagtggcgggtggctggtgtaggcgcggagcccattgcgatttccacgctgaaccgc
ttcgccgagcactttgctcctgcgggctttaaagcaagtgcattcatgccatgttatggc
ctggccgaaaatacgttagccgtcagcttcgcagcgcctggagctggcgggcaggttgat
cgagtggaccgggacattctggaactagaagggcgggcagttaaagccactgaacaatcc
gcggccgtcagcacatttgttaattgtggtcgccctctgccgggtcatcaactacaggtg
ctagatgacactggccatgcactcgccgagcgatgcatcggtcgaattgtcatttctggc
ccaagcctcatggcagggtactttgaggatcaggagtcgagacagcagctggaagttaca
cgatggctggacaccggtgatctgggttatctgcttgacggtgacttgtatgtcaccggg
cgcaagaaggacctgatcattatccggggtaggaacatctggccccaggatatcgagctg
gtcgccgaatcagagcccgaggtcaggccgggagacgccatcgtgttcattgtgcaagac
aacggggagacgtcggtagtagtacaggtgcaatgtcggatcgtcgctcaagaggcgcgc
gaacgactactgcacaccttgtttgccaagatccacagtgagttcgggctctcacccatg
atcgagctcgttccaccacatagcattcctcgcacctcatcaggcaaacctgcgcgagct
gaagcgcgtaagcgctttctcagtcagctggtggtgcgccaggaaaccttcgccgtcgca
ggttccgcgtga

DBGET integrated database retrieval system