KEGG   Pseudomonas mandelii: OU5_3545Help
Entry
OU5_3545          CDS       T03626                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pman  Pseudomonas mandelii
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pman00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OU5_3545
Enzymes [BR:pman01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     OU5_3545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4010380..4011312)
Genome map
AA seq 310 aa AA seqDB search
MQSLFLIESCPMSTPNVEAVKLDELNCWRIRHGQAELLVAQQGAHILSYQLAGQPPLIWL
NDEAVFKTGKSIRAGVPVCWPWFGNFKRNPQSVQAMRVSNEPPTAHGFVRAMDWELGGIE
TEGESLKVEFVLPYPEGGFPGWPHQVDLKLSIRLDEQLHISLTSHNQGTDTVTISQALHS
YFAVSDVRTVHVEGLDGLSYIETLDDWKTVTQTGDLRFTGETDRIYLNTPAKLSIVDPAW
KRRIELTSSGSRSAVIWNPWIERAAAFSDMADDGWQKMLCIETANVMDDVVTLKPGATHT
LEVSIASNPL
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
ttgcagtcattgttcctgatcgagagttgccccatgagcacgcccaacgttgaagccgtg
aaactggatgaactgaactgctggcgcatccgccacggtcaggccgaattgctggttgcg
cagcaaggcgcgcacatcctcagttatcaattggccggccaaccgccgctgatctggctt
aacgatgaggccgtgttcaagactggcaagagcatccgcgccggcgtgccggtgtgctgg
ccgtggttcggcaatttcaagcgcaacccgcaaagcgtccaggcgatgcgcgtcagcaac
gaaccgccgaccgcccacggttttgtccgggcgatggattgggaattgggcggcatagaa
accgagggcgagagcctgaaggtggaattcgtcctgccctaccccgaaggcggctttcca
ggctggccacatcaggtcgatctgaagttgagcatccgtctggatgagcaactgcacatc
agcttgaccagccacaatcagggcaccgataccgtcaccatcagccaggcgttgcacagt
tacttcgctgtcagcgatgtgcgcacggtgcatgtcgaagggctggatggcttgagctat
atcgaaacgctggacgactggaaaaccgtgacccagaccggcgatctgcgctttaccggc
gaaaccgaccgtatctacctcaataccccggcgaagctgagcattgtcgacccggcctgg
aaacggcgcattgagctgaccagcagtggttcgcgctcggcggtgatctggaacccgtgg
atcgaacgcgcagcggcgttcagcgacatggccgacgatggctggcagaagatgctgtgc
atcgagacggcgaatgtgatggatgatgtggtcacgctgaaacccggcgccacccacact
ctcgaagtcagcatcgccagcaaccctttataa

DBGET integrated database retrieval system