KEGG   Pseudomonas mandelii: OU5_4095Help
Entry
OU5_4095          CDS       T03626                                 

Gene name
tufB
Definition
(GenBank) elongation factor TU
  KO
K02358  
elongation factor Tu
Organism
pman  Pseudomonas mandelii
Brite
Translation factors [BR:pman03012]
 Eukaryotic Type
  Elongation factors
   OU5_4095 (tufB)
 Prokaryotic Type
   OU5_4095 (tufB)
Mitochondrial biogenesis [BR:pman03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    OU5_4095 (tufB)
Exosome [BR:pman04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   OU5_4095 (tufB)
  Exosomal proteins of breast cancer cells
   OU5_4095 (tufB)
  Exosomal proteins of colorectal cancer cells
   OU5_4095 (tufB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4613529..4614722
Genome map
AA seq 397 aa AA seqDB search
MAKEKFDRTLPHVNVGTIGHVDHGKTTLTAALTRVCSEVFGSAVVAFDKIDSAPEEKARG
ITINTAHVEYNSLIRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKADMVDDAELLELVEMEVRDLLSTYDFPGDDTPIIIGSALMALN
GQDDNEMGTTAVRKLVETLDSYIPDPVRVIDKPFLMPIEDVFSISGRGTVVTGRIERGIV
KVQDPLEIVGLRDTTVTTCTGVEMFRKLLDEGRAGENCGVLLRGTKRDDVERGQVLVKPG
SVKPHTKFEAEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGNCELPEGVEMVMPGDNI
KMVVTLIKTIAMEDGLRFAIREGGRTVGAGVVAKIIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtggctaaagaaaaatttgaccgtaccctcccgcacgtcaacgttggcaccatcggtcac
gtcgaccacggtaaaaccacgctgaccgctgctctgactcgcgtctgctccgaagttttc
ggttcggccgttgttgctttcgacaaaatcgacagcgctccggaagaaaaggctcgtggt
atcaccatcaacaccgcgcacgttgaatacaactcgctgatccgtcactacgctcacgtt
gactgcccaggtcacgctgactacgtgaagaacatgatcaccggtgctgctcagatggac
ggcgctatcctggtttgctcggccgctgatggtccgatgccacaaacccgtgagcacatc
ctgctgtcccgtcaggttggcgttccgtacatcgttgtcttcctgaacaaggctgacatg
gttgacgacgctgagctgctggaactggttgagatggaagtgcgcgacctgctgagcact
tacgacttcccaggtgacgacactccgatcatcatcggttcggctctgatggctctgaac
ggccaagacgacaacgaaatgggcaccactgctgttcgtaagctggttgagactctggac
agctacattccagatccagttcgcgttatcgacaagccgttcctgatgccaatcgaagac
gtattctcgatctccggtcgcggtactgttgtaactggccgtatcgagcgcggtatcgtc
aaggttcaggatccactggaaatcgttggtctgcgtgacactaccgtcaccacctgcacc
ggtgttgaaatgttccgtaagctgctcgacgaaggtcgtgctggcgagaactgcggcgtt
ctgctgcgtggtaccaagcgtgacgacgttgagcgtggccaggttctggttaagccaggt
tcggtcaagccgcacaccaagttcgaagctgaagtctacgttctgagcaaagaagaaggc
ggtcgtcacactccgttcttcaaaggctaccgtccacagttctacttccgtactactgac
gtgactggtaactgcgaactgccggaaggcgttgaaatggtaatgccgggcgacaacatc
aaaatggttgtcaccctgatcaagaccatcgcaatggaagacggtctgcgtttcgctatc
cgtgaaggcggtcgtaccgtcggcgctggcgtcgtagccaaaatcatcgagtaa

DBGET integrated database retrieval system