KEGG   Prochlorococcus marinus AS9601: A9601_17821Help
Entry
A9601_17821       CDS       T00464                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pmb  Prochlorococcus marinus AS9601
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A9601_17821 (ppc)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    A9601_17821 (ppc)
   00680 Methane metabolism
    A9601_17821 (ppc)
Enzymes [BR:pmb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     A9601_17821 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
complement(1513603..1516572)
Genome map
AA seq 989 aa AA seqDB search
MESFRQVKNNNVDLISNNDPLDKNRLLIEDLWESVLREECPDDQAERLIQLKELSYSKQI
DGDSSKTFKNEIVDIVNSMDLAESIAAARAFSLYFQLVNILEQRVEEDRYIQSFTNKDVQ
KSPDNLDPFAPALARQNAPVTFRELFYRLRKLNVPPGKLEELLQEMDIRLVFTAHPTEIV
RHTIRHKQTRVANLLKKIQIEQFLTKEEKNSLKTQLKEEVRLWWRTDELHQFKPSVLDEV
DYALHYFQQVLFNAMPQLRGRIAEALTDNYPDVQLPSESFCNFGSWVGSDRDGNPSVTPE
ITWRTACYQRQLMLERYIIATSNLRDQLSVSMQWSQVSSSLLESLETDRVKFPEIYEARA
TRYRSEPYRLKLSYILEKLRLTQERNNLLADSGWKFDLEGETDNKNLDKVESLYYKSVKE
FTYDLELIKNSLISTDLNCESVNTLLTQVHIFGFSLASLDIRQESTRHSDAIQELTNYLD
LSVQYDQMSEEEKIKWLIDELNTKRPLIPSDVHWTKTTEETFSVFKMVKRLQQEFGSRIC
HSYVISMSHSASDLLEVLLLAKEMGLLDQNSQKSKLLVVPLFETVEDLKRAPEVMEKLFK
LDFYRSLLPKVGESFKPLQELMLGYSDSNKDSGFVSSNWEIHRAQIALQNLSSRNNILLR
LFHGRGGSVGRGGGPAYQAILAQPSGTLKGRIKITEQGEVLASKYSLPELALYNLETVTT
AVIQNSLVNNRLDATPEWNQLMSRLAETSRSHYRKLVHENPDLLNFFQEVTPIEEISKLQ
ISSRPARRKKGAKDLSSLRAIPWVFGWTQSRFLLPSWFGVGTALSSELNLDPQQIELLRV
LHQRWPFFRMLISKVEMTLSKVDLEVARYYVDTLGSKENKDSFDNIFEVISKEYNLTKSL
ILEITGKNKLLESDRDLKSSVSLRNKTIIPLGFLQVSLLRRLRDQTRQPPISEFFLDKDE
STRAYSRSELLRGALLTINGIAAGMRNTG
NT seq 2970 nt NT seq  +upstreamnt  +downstreamnt
atggaatcttttcgccaggtaaaaaataataatgtggatctgataagtaacaatgatcca
cttgataaaaatcgtcttctaattgaagatctctgggaatctgtgctaagagaagaatgc
ccagatgatcaagcagaaaggttgatacagcttaaagaattaagttattcaaaacaaatt
gatggcgatagttcaaaaacttttaaaaatgaaatagttgatattgtaaattctatggat
ttagcagaatccatagctgcagcaagggctttttcattatattttcaacttgtgaatatt
ttggaacaaagagttgaggaagatagatatattcaaagctttaccaataaggatgttcaa
aaatcgcccgacaatcttgatccttttgccccagcattggctaggcaaaatgctcctgta
acttttagagaattgttttacaggcttaggaaactaaatgtgccaccaggcaaattagaa
gagttattacaggaaatggatattcgtttagtttttactgcacatccgacggagatagta
agacatacgattagacataagcagacaagagtagcaaatttgttaaaaaaaatacagatt
gagcaatttctgacaaaagaagaaaaaaattctttaaaaacccaattaaaagaggaagta
agactttggtggaggactgatgaattgcatcaatttaaaccttcagttttagatgaagtt
gattatgccttgcattattttcagcaagttttatttaatgcgatgcctcagttgagggga
aggatcgctgaagcacttaccgataattatccagatgttcagttgccctcagaatctttt
tgcaacttcggttcttgggtaggctctgatagggacggtaatccatcggtcactcctgag
ataacatggagaactgcttgctaccaaaggcagttgatgttggaaagatatattattgcg
acgtctaatcttagagatcaattaagtgtttcgatgcaatggagtcaagtcagttcctcc
ttattagagtcacttgaaactgacagggttaagttccctgaaatatatgaagctagagct
acaaggtatagatcagaaccctacagattaaaattaagttatatcctagagaaattaaga
ttaacacaagaaagaaataatttattagctgatagtggatggaaatttgacttggaagga
gaaactgataacaaaaatttagataaagttgaaagcttatattacaagtcagtaaaagaa
tttacttatgatctagaacttatcaaaaatagtttaattagtacagatttaaattgtgag
tctgtaaacaccttacttactcaagttcatatttttggattttccttagcaagtttagat
attcgtcaagagagtacaaggcatagtgacgctattcaagagcttacaaattatcttgat
ttatctgttcaatatgaccaaatgtctgaggaagagaaaattaaatggcttatagacgaa
ttaaatacaaaaaggcctttaattccatctgacgttcactggacaaaaaccacagaagaa
acattttcagtttttaaaatggttaagagactacagcaagaatttggaagtcgcatttgt
cattcttatgtaatttcaatgagtcatagtgcatctgatttgcttgaagttctcttactg
gcaaaagaaatgggacttcttgatcaaaattcacaaaagtcaaaattattagttgttcct
ctttttgaaactgtggaagaccttaaaagagcaccagaagtaatggaaaagttgtttaaa
ttagatttctatagatcattattgccaaaagtaggagaatcttttaaacctctgcaagaa
ttaatgcttggatattctgatagcaataaagattcggggtttgtttctagtaattgggaa
attcatagagcccaaatagctcttcaaaatctttcaagtaggaataacatattgttaaga
ctgtttcatggaagaggtggttctgtaggtagaggaggaggaccagcctatcaggcaata
ttggctcaaccaagcggtactttaaaagggcgaataaaaataacagaacaaggagaagtt
ttagcttctaaatatagtcttccggaacttgctttatacaatcttgaaactgtaactaca
gcggtaattcaaaatagcttggtaaataatagacttgacgctactccagaatggaatcaa
ttaatgtctaggttggcagaaacatcaaggtctcactaccgaaaattagtgcatgagaat
cctgacttgttgaatttctttcaagaggtcactccaatagaagaaataagtaaattacag
atatccagtaggcctgcaagaagaaaaaaaggtgcaaaagatttatcaagtttacgagct
attccatgggtatttggatggacacaaagtagatttcttttaccaagttggtttggagta
ggtactgcattgtcatctgaattaaatttagatccacaacaaattgaattactaagagtc
ttgcatcaaagatggccattttttaggatgcttatatctaaggtagaaatgacattatct
aaggtggatttagaagtggcaagatattatgttgatactcttggcagtaaagaaaataaa
gattcttttgataatatttttgaagtaatttctaaagaatataatctcacgaaatcttta
atacttgaaattactggtaaaaataagcttcttgaatctgatagagacttgaagtcatct
gtaagcttgagaaataagacaatcattccattggggtttttgcaagtttcacttttaaga
agattaagagaccagacaagacaacccccaataagcgagttttttctggataaagatgaa
tctacaagagcttacagcagaagtgaactattaaggggagcacttttaactattaatggg
atagcagctggtatgagaaatacaggataa

DBGET integrated database retrieval system