KEGG   Prochlorococcus marinus MIT 9515: P9515_09951Help
Entry
P9515_09951       CDS       T00465                                 

Gene name
pykF
Definition
(RefSeq) pyruvate kinase (EC:2.7.1.40)
  KO
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
pmc  Prochlorococcus marinus MIT 9515
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pmc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    P9515_09951 (pykF)
   01230 Biosynthesis of amino acids
    P9515_09951 (pykF)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P9515_09951 (pykF)
   00620 Pyruvate metabolism
    P9515_09951 (pykF)
  Nucleotide metabolism
   00230 Purine metabolism
    P9515_09951 (pykF)
Enzymes [BR:pmc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     P9515_09951 (pykF)
Exosome [BR:pmc04147]
 Exosomal proteins
  Proteins found in most exosomes
   P9515_09951 (pykF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
888621..890411
Genome map
AA seq 596 aa AA seqDB search
MSNIDLKRRTKIVATIGPATQSEEVITDLIKAGVTTFRLNFSHGDHKDHEERIKTIRKVS
KNLDLDVGILQDLQGPKIRLGRFKDGPVKVKKGDKFTLTSNEVECTKSIANVTYNRLAQE
VTEGKRILLDDGKIEMIVEKVDLPNNLLKCKVTVGGVLSNNKGVNFPDVQLSVKALTDKD
IDDLEFGLTAGVDWIALSFVRNPSDINEIKNLINKSGQSIPVIAKIEKFEAIDQIDSILP
LCDGVMVARGDLGVEMPAEEVPLLQKELIRKANTFGIPIITATQMLDSMASNPRPTRAEV
SDVANAILDGTDAVMLSNETAVGDYPVEAVETMATIARRIERDYPLKAIESNLPSTIPNA
ISAAVSNIARQLDAGAIIPLTKSGSTARNVSKFRPPTPILATTTEKSVARRLQLVWGVTP
LLVKSDDRTARTFSIAMQIAQEMGILKQGDLVVQTAGTLTGISGSTDLIKVGLVRKVITR
GISIGEIGVTGKARNIETSLDLSLITHGEILFVSKNLLKDLPYSKKITGIVTDETVDECY
KIFKKNKIKISSICNLSTIDNQVTNGDVITLQLNEGVIYMGQIEEDEEALDRYKYV
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatattgatttaaaaagaagaacaaaaattgtagcaacaattggaccagctact
cagtctgaagaagtaattactgatcttataaaggctggggtaacaacattccgattaaat
ttttcccatggcgatcataaagatcatgaagaaaggattaaaactataagaaaagtttct
aaaaatcttgatctagatgtaggaatactacaagatctgcaaggacctaaaataagacta
ggaagatttaaagatggtcccgttaaagtaaaaaaaggagataaatttacattgacttct
aacgaagttgaatgcactaaaagtattgcaaacgttacttataatagactcgcgcaggaa
gttaccgaaggcaaaagaatattattagacgatggtaaaattgaaatgattgttgaaaag
gttgacttaccaaataatttattaaagtgtaaagtaactgtcggtggggtactttctaac
aataaaggagttaattttccagatgtgcaattatcggtaaaagctttaactgataaagat
atagatgatcttgaatttggattaaccgctggagtagattggatagctctaagttttgta
agaaacccctcagatattaatgaaataaaaaatttaataaataagagtgggcaatcaata
cctgtgatagcaaaaattgaaaaatttgaagcaatagatcaaatagattcaatactaccc
ttgtgtgatggagttatggttgcaagaggagatttaggagttgaaatgccagcggaggaa
gttccacttttacaaaaagagttaataaggaaagctaatacatttgggatccctataatc
acggctacacaaatgcttgactccatggcatcaaatcccagaccaacacgagcggaagtt
agtgatgtggctaacgcaattcttgatgggactgatgcagttatgctctcaaatgaaact
gccgtaggtgactatcctgtagaggctgttgaaactatggctactattgccagaagaatt
gaaagagattatccattaaaagcaatcgagagtaatctgcctagtactatcccaaatgca
ataagtgctgcagtaagcaatattgcgaggcagcttgacgctggagcaataattccttta
actaaatcaggatccacagcacgtaatgtaagtaagttcagaccacctactcctatcctt
gccacgactactgagaagagtgtcgcaagaagattacaacttgtgtggggagtgacacca
ttattagtaaaatctgacgatagaacagcaagaacatttagtattgcaatgcaaatagct
caagaaatggggattcttaagcaaggagacttagtagtacaaactgctggaactttgaca
ggaataagtggatctactgaccttataaaagttggcctagtaagaaaagtgataacccga
ggaatatcaattggagaaataggtgttacaggtaaagcgagaaatatagaaacaagtctt
gatttatcattaataactcacggtgaaatattatttgtatctaagaatctattaaaagat
ttaccttactcaaaaaaaatcacaggcatcgttactgatgaaactgttgatgaatgttat
aagatttttaaaaaaaataaaattaaaatatcttcaatttgtaatttatctactattgat
aatcaggtaacaaatggtgatgtaataacactacaacttaatgaaggagtaatttatatg
ggacagatagaggaagatgaagaggcactagacagatataaatatgtctag

DBGET integrated database retrieval system