KEGG   Prochlorococcus marinus NATL1A: NATL1_06041Help
Entry
NATL1_06041       CDS       T00467                                 

Gene name
rbcL
Definition
(GenBank) Ribulose bisphosphate carboxylase, large chain
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
pme00630  Glyoxylate and dicarboxylate metabolism
pme00710  Carbon fixation in photosynthetic organisms
pme01100  Metabolic pathways
pme01120  Microbial metabolism in diverse environments
pme01200  Carbon metabolism
Module
pme_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pme_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
pme_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pme00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NATL1_06041 (rbcL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NATL1_06041 (rbcL)
Enzymes [BR:pme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     NATL1_06041 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ABM75166
CyanoBase: NATL1_06041
CYORF: NATL1_06041
UniProt: A2C106
LinkDB All DBs
Position
549278..550690
Genome map
AA seq 470 aa AA seqDB search
MAKKYDAGVKEYRDTYFTPDYVPLDTDLLACFKCTGQEGVPKEEVAAAVAAESSTGTWST
VWSELLVDLEFYKGRCYRIEDVPGDKDAFYAFIAYPLDLFEEGSITNVLTSLVGNVFGFK
ALRHLRLEDIRFPMAFIKTCGGPPSGIVVERDRLNKYGRPLLGCTIKPKLGLSGKNYGRV
VYECLRGGLDLTKDDENINSQPFQRWRERFEFVAEAVKLAQQETGEVKGHYLNCTATTPE
EMYKRAEFAKELDMPIIMHDYITGGFTANTGLANWCRENGMLLHIHRAMHAVIDRHPQHG
IHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQTTLGYIDNLRESFVPEDRTRGNFFDQDW
GSMPGVFAVASGGIHVWHMPALLAIFGDDSCLQFGGGTHGHPWGSAAGAAANRVALEACV
KARNAGREIEKESRDILLEAAKHSPELAIALETWKEIKFEFDTVDKLDVQ
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaagtatgatgctggagttaaggagtatagagatacttacttcactcctgat
tacgtccccctagatactgatctacttgcatgttttaaatgcacaggtcaggaaggtgta
cctaaagaagaagttgcagcagctgttgcggctgaatcatctacaggtacatggtcaaca
gtttggtcagaattacttgtagatcttgaattctacaaaggccgctgttaccgcattgaa
gatgtccctggtgacaaggatgccttctatgcatttattgcttatcccttagatcttttt
gaagaaggatctataactaacgttttgacatcacttgttggaaacgtctttggttttaaa
gctttgcgtcatcttcgacttgaagatattcgcttcccaatggcatttatcaaaacctgc
ggcggaccacctagtggaatagtagttgaacgtgatcgtcttaataaatacggtcgtcca
ttacttggttgtactattaagccaaaacttggtctttctggtaaaaactacggtcgtgtt
gtttacgaatgccttcgtggtggtcttgatctaactaaagatgatgagaatatcaattct
cagccattccagcgttggagagagcgttttgaatttgttgctgaagctgtaaagctagct
caacaggaaactggtgaagttaaaggtcactacctgaattgcacagcaactactcctgaa
gagatgtataagcgtgctgagttcgctaaagaacttgacatgccaatcatcatgcatgac
tacataactggtggttttactgctaatacaggtcttgctaattggtgccgtgaaaatggc
atgcttcttcatattcaccgtgctatgcatgcggttatcgaccgtcatcctcagcatggt
atccacttcagagttcttgctaagtgtttgcgtctatctggcggagatcaacttcatacc
ggaacagttgttggaaaactagaaggagatcgtcaaacaactcttggttatatcgataac
ctacgtgaatcctttgttcctgaagaccgtactcgcggtaacttctttgatcaagattgg
ggttctatgcctggtgtatttgctgtggcatctggtggtattcatgtttggcatatgcca
gcattgcttgcaatctttggagatgattcatgtctccaatttggaggtggtacccatgga
cacccttggggatcagctgctggtgcagccgctaaccgagtagctctagaggcatgtgtg
aaagcgcgtaatgcaggcagagaaatcgaaaaagaaagtcgcgatatccttctagaagcc
gcaaagcatagccctgagttggcaattgctcttgagacatggaaggagattaagttcgaa
ttcgatacagtcgataaactcgacgttcagtag

DBGET integrated database retrieval system