KEGG   Prochlorococcus marinus MIT 9303: P9303_21291Help
Entry
P9303_21291       CDS       T00466                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pmf  Prochlorococcus marinus MIT 9303
Pathway
pmf00010  Glycolysis / Gluconeogenesis
pmf00020  Citrate cycle (TCA cycle)
pmf00620  Pyruvate metabolism
pmf01100  Metabolic pathways
pmf01110  Biosynthesis of secondary metabolites
pmf01120  Microbial metabolism in diverse environments
pmf01130  Biosynthesis of antibiotics
pmf01200  Carbon metabolism
Module
pmf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pmf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P9303_21291 (pdhC)
   00020 Citrate cycle (TCA cycle)
    P9303_21291 (pdhC)
   00620 Pyruvate metabolism
    P9303_21291 (pdhC)
Enzymes [BR:pmf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     P9303_21291 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DUF711
Motif
Other DBs
NCBI-ProteinID: ABM78864
CYORF: P9303_21291
UniProt: A2CBK4
LinkDB All DBs
Position
complement(1893868..1895187)
Genome map
AA seq 439 aa AA seqDB search
MPALSSTMTEGKIVEWLKQPGDKVGRGESVLVVESDKADMDVESFQDGYLAAVLMPAGRS
APVGETIGLIVESEAEIAAVQANAPAAPASDPAPLKAAAKVVDDHAPASTPAPVVESPPV
AAPPPVTSQAVESDKRIVASPRAKKLAAQMGVDLAKLRGSGPHGRIQAEDVQLAAGQPIS
VPQVAEGNASFATTHATSAGVAHAVSSPVGQSFGAPGETAAFNNLQQAVNRNMEASLAFP
CFRVGYTITTDQLDAFYKQVKPKGVTMTALLAKAVALTLVRHPQVNAAYSTAGMVYPEQV
NVAIAVAMDDGGLITPVLQNADRTDLYEMSRQWADLVKRSRSKQLQPEEYSTGTFTLSNL
GMFGVDRFDAILPPGTGAILAVAASRPAVVAGKDGSIGVKRQMQVNLTADHRVIYGADGA
AFLKDLAELIETRVESLAL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctctgagctcaacgatgacggagggcaagatcgttgagtggcttaagcaacct
ggcgacaaggttgggcgtggtgagtcggtgcttgtggtggagtcagataaagcggatatg
gatgtggagtcatttcaagatggctacttggccgcggtcttgatgcctgctggtcgttcg
gctccagtgggtgaaacgattggtttgatcgttgaaagtgaggccgaaatcgcggctgtt
caggccaatgcccctgctgcgccagcgtctgatcctgcccctctcaaggccgctgcaaaa
gttgtcgatgaccatgccccagcatctactccggcgcccgtcgtggagagtccccctgtt
gctgcgccgccgcctgttaccagccaagcagtagagagtgacaaacgcatcgttgcttcc
ccgcgggctaaaaaacttgctgcgcagatgggtgttgatctggccaagttgagaggtagc
ggaccccatggccgtatccaggctgaagacgtgcagctggctgcaggtcagccgatcagt
gtgcctcaggttgctgaaggaaacgcttctttcgcaacgacgcatgcaacttctgcaggc
gttgctcatgcagtgtcatctcctgtaggtcagagctttggggccccgggagaaaccgca
gccttcaacaacctccaacaagcggtcaaccgcaatatggaggccagtttggccttcccc
tgcttcagggttggctacacgatcacgactgatcagttggatgctttttacaagcaggtg
aagcctaagggcgtcacgatgacagcccttctggccaaagccgtggccttgacgcttgtg
cgtcatccccaggtgaatgctgcctacagcactgctgggatggtttatccagagcaggtg
aatgttgctattgcagtggcgatggacgatggcggtctgattacaccggttttgcagaat
gctgatcgcactgatctctatgagatgtcgcggcagtgggccgatcttgtgaagcgttca
cgcagcaagcagctgcaacccgaggaatacagcactggtactttcacactctccaatctg
ggcatgtttggtgtggatcgctttgatgcaatcttgccccctggcactggcgcaattttg
gcggtagctgcatcgcggcctgctgtggtggcaggaaaggatggctcgattggggtcaag
cgccagatgcaggtgaacctcactgccgaccatcgcgtgatttatggcgccgatggggcg
gccttccttaaggacctggcagagctgattgagacgcgggtagagagtttggcgctctga

DBGET integrated database retrieval system