KEGG   Prochlorococcus marinus MED4: PMM0550Help
Entry
PMM0550           CDS       T00142                                 

Gene name
rbcL, cbbL
Definition
(GenBank) Ribulose bisphosphate carboxylase, large chain
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
pmm  Prochlorococcus marinus MED4
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pmm00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PMM0550 (rbcL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PMM0550 (rbcL)
Enzymes [BR:pmm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     PMM0550 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
519087..520502
Genome map
AA seq 471 aa AA seqDB search
MSKKYDAGVKEYRDTYWTPEYVPLDTDLLACFKCTGQEGVPREEVAAAVAAESSTGTWST
VWSELLTDLEFYKGRCYRIEDVPGDPEAFYAFIAYPLDLFEEGSITNVLTSLVGNVFGFK
ALRHLRLEDIRFPIAFIKTCGGPPNGIVVERDRLNKYGRPLLGCTIKPKLGLSGKNYGRV
VYECLRGGLDLTKDDENINSQPFQRWRERFEFVAEAVKLAQQETGEVKGHYLNCTANTPE
ELYERAEFAKELDMPIIMHDYITGGFTANTGLANWCRKNGMLLHIHRAMHAVIDRHPKHG
IHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQTTLGYIDNLRESFVPEDRSRGNFFDQDW
GSMPGVFAVASGGIHVWHMPALLAIFGDDSCLQFGGGTHGHPWGSAAGAAANRVALEACV
KARNAGREIEKESRDILMEAAKHSPELAIALETWKEIKFEFDTVDKLDVQG
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagaagtatgacgctggggtaaaggagtacagagatacctactggactcctgaa
tatgtccccctcgacactgatttgttagcctgtttcaaatgcacaggccaagaaggtgtc
ccaagagaagaagttgcagcagcggtagcggctgaatcttctactggtacttggtcgact
gtttggtccgagttacttaccgaccttgaattttacaaaggccgttgttatcgaatcgaa
gacgttcctggtgatccagaagccttttatgcatttattgcataccctttagatcttttc
gaagaaggttcaatcacaaacgtattaacctctttagtaggtaacgtatttggatttaaa
gctttaagacatctccgtcttgaagatattagattcccaattgcttttattaagacctgt
ggtggaccacctaacggaatagtagttgaaagagatcgacttaataagtatggaagacca
cttctaggttgtaccatcaaacctaaattaggattgtctggtaagaactacggaagggtt
gtctatgaatgccttagagggggtcttgatctaactaaagatgatgagaatatcaattct
cagccattccaacgttggagagaacgatttgagttcgttgctgaagccgttaaacttgct
cagcaagaaactggagaagtaaaaggtcattatttaaattgcaccgctaatacccctgaa
gaactatacgaacgtgcagagtttgctaaagagcttgatatgccaatcatcatgcatgat
tacataactggtggatttacagcaaatactggccttgcaaactggtgtcgtaaaaatggc
atgcttctgcatatacacagagctatgcacgctgttattgatagacatccaaaacatggt
atccacttcagagttctagcgaaatgtttaagactctctggaggagaccagttacatact
ggaaccgttgttgggaaactagaaggtgatcgtcaaactactcttggttacattgataac
ttaagagaatcatttgttcccgaagacagatcaagaggtaacttctttgatcaagattgg
ggatcaatgcctggagtttttgctgttgcatctggtggtatccacgtttggcatatgcca
gcactgcttgcaatatttggagatgattcttgtcttcaattcggaggaggaactcatggt
catccatggggttcagctgccggagctgctgcaaaccgtgttgcattagaagcttgtgtg
aaagcacgtaatgcaggtcgcgaaatcgaaaaagagagtagagacattctaatggaagct
gctaagcatagtcctgaattagctattgcactcgaaacttggaaagaaatcaagtttgag
tttgataccgttgataagctcgacgttcaaggctaa

DBGET integrated database retrieval system