KEGG   Prochlorococcus marinus NATL2A: PMN2A_1147Help
Entry
PMN2A_1147        CDS       T00267                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PMN2A_1147
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PMN2A_1147
   00680 Methane metabolism
    PMN2A_1147
Enzymes [BR:pmn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PMN2A_1147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
complement(1632922..1635906)
Genome map
AA seq 994 aa AA seqDB search
MLKNPSNENISNHSTVCVEDQDPGSLLQQRLELVEDLWKTVLKSECPPDQTERLLRLKQL
SDPSKSNQDNSSKAIVQLITKMDLAEAISAARAFSLYFQLVNILEQRIEEDSYLESIEKG
KLDTSNYKIDPFAPALASQTAPATFTQLFERLRRLNVPPAQLDGLMREMDIRLVFTAHPT
EIVRHTVRHKQRRVATLLQQLQSNSLISESEKEIFRLQLEEEIRLWWRTDELHQFKPTVL
DEVDYALHYFQQVLFDAMPQLRRRLTTALASSYPDVEIPNEAFCTFGSWVGSDRDGNPSV
TPEITWRTACYQRQLMLDRYIASVQDLRDQLSISMQWSQVSSPLLESLEMDRVRFPEVYE
ERAARYRLEPYRLKLSYTLERLRLTQLRNKQLADAGWQFSPDGKPLISTNNSFDEVLHYK
SVEELKNELELIRNSLVSTDLTCEPLDTLLNQVHIFGFSLASLDIRQESTRHSDALDELT
RYLDLPESYGVMSEESRVQWLMKELRTRRPLIPPSFEWSKSTQETISVFHMLHRLQKEFG
TRICRSYVISMSHTASDLLEVLLLAKESGLIDPTLGASDLLVVPLFETVEDLQHAPSVME
SLLQTDVYRELLPRVGEKKQPLQELMLGYSDSNKDSGFLSSNWEIHKAQIALQDLASRQG
IALRIFHGRGGSVGRGGGPAYQAILAQPSGTLQGRIKITEQGEVLASKYSLPELALYNLE
TVTTAVIQNSLVTNKLDATPSWNELMTRLAARSREHYRALVHDNPDLVQFFQVVTPIEEI
SKLQISSRPARRKSGAKDLSSLRAIPWVFGWTQSRFLLPSWFGVGTALATELKADPDQME
MLRMLNQRWPFFRMLISKVEMTLSKVDLDVAHHYVVSLGGSDDRDAFARIFDIISSEYSL
TKKLILEITGKSKLLSADPALQLSVNLRNRTIVPLGFLQVALLKRLRDQNRQPPISEDVS
IDSTQSSRTYSRSELLRGALLTINGIAAGMRNTG
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaaatccttctaacgaaaatatctctaatcactcgacagtatgtgttgaggat
caagatcctggatctttattgcaacaaaggcttgaactagtggaggatctatggaaaacc
gttctcaaaagtgaatgtccacctgatcaaacagagagattattgcgattaaaacaatta
agtgatcctagtaagtcaaatcaagacaattcctcaaaggcaatagtccaattgattaca
aaaatggatttggctgaggcgatatctgctgctagggctttttctctttattttcagttg
gtaaacattctggagcaacgcatagaagaggatagttatttagaaagcatagaaaaaggg
aagttagacaccagtaattataaaatagatccattcgctccagctttagctagtcagact
gctccagcaacttttacacaattatttgagcgattacgtcgtttgaatgtccctccagct
cagcttgatggtttgatgagagaaatggatattcgtcttgtttttacagctcatccaact
gaaatagttagacacacggttcgccataagcaacgcagggttgccactcttttgcagcaa
cttcaatctaatagcttgatttccgaatcagagaaagaaatatttaggttgcagctagag
gaggagataagactttggtggagaactgatgagcttcatcaattcaaaccgactgtcctt
gatgaggttgactatgcccttcattattttcagcaggttttgtttgatgcaatgcctcaa
ttaagaaggagactgactaccgcacttgcttcaagttatccagacgtagagatccctaat
gaagctttttgcacatttggctcttgggtaggttcagatcgtgatgggaatccgtcagtt
actcctgaaatcacatggagaacagcgtgttaccaaagacaattaatgttggataggtat
attgcatcagttcaagatctaagagaccaactcagtatatctatgcaatggagtcaagta
agttctcctttgttagagtcattggaaatggacagagttcgtttccctgaggtttatgag
gaaagggctgcaagatatagactggaaccttatcgcttgaagcttagctatacacttgag
aggctacgacttactcaactacgtaataagcagctagcggatgctggatggcaattctca
cccgatgggaaaccgctaatatctactaataatagttttgatgaagtactccactacaaa
tctgtagaagaattaaaaaatgaattagagcttattagaaatagtttggttagtacagat
cttacttgtgaaccattagatactttgctaaatcaagttcatatttttgggttctcgttg
gctagtttagacattaggcaagaaagcacacgacatagtgatgcgttggatgagctcact
cgctatttagatctccctgagtcgtatggagtgatgagcgaggaaagtcgagttcaatgg
ttgatgaaagaattaagaactcggagaccacttatcccgccttcttttgagtggtctaaa
agtactcaagaaactatctcagtttttcatatgcttcataggcttcagaaagaatttggt
actcgtatatgtcgctcgtatgtaatttcgatgagtcatacggcatcagatttattagaa
gttcttcttttagctaaagagtcgggtttgattgatccaactttaggagcttctgatctt
ctcgttgttccattatttgaaacggttgaggacttacaacatgctccttctgtaatggag
tcgttactacaaactgatgtttatcgcgaattacttccacgagtaggagagaaaaaacaa
ccgcttcaggaacttatgctgggatattccgatagtaataaggattctggttttctctca
agtaattgggaaattcataaggcccaaatagcactccaagacctagctagtagacaagga
atagcattacgtatttttcatggtagaggtgggtctgtaggaagaggcggtggaccagct
tatcaagctattttggctcaacctagtggtacacttcagggacgtataaaaataacagag
caaggggaagtacttgcttcaaaatatagtcttccagaattagctttatataatctggaa
actgtaaccactgcagttattcaaaatagcttggttaccaataaattggatgctacgcca
agttggaatgaattgatgaccagacttgcagctcgttcaagggagcattaccgagcctta
gttcatgataatccagatttagttcaattttttcaggtagttactccaatagaagagatt
agtaagttgcaaatttctagtcgtcctgctcgacgaaagagtggtgcaaaagacttatca
agtcttcgagctatcccatgggtctttggttggactcaaagtcgtttccttttgccaagt
tggtttggtgttggtacggctttagctactgaattaaaggctgaccccgaccaaatggag
atgttgcgaatgttgaatcagagatggccattctttagaatgttgatatctaaagtagag
atgacactttcaaaagttgatttagatgttgcccaccattatgtggttagtttgggtgga
agtgatgatcgggatgctttcgctagaattttcgatattatctcaagcgaatacagcttg
actaagaaattaattttagaaattactggcaagtcaaaactattaagtgcagaccctgct
ttgcagttgtctgtcaacctgagaaataggactattgtccctttaggatttttacaagta
gctcttctcaagcgattaagagatcagaatcgtcaaccaccaattagtgaagatgtaagt
attgactctactcaaagttctcgtacatatagtcgtagtgaattattgcgtggtgcattg
ttgactatcaatggtatcgctgcaggtatgagaaacacaggatga

DBGET integrated database retrieval system