KEGG   Prochlorococcus marinus NATL2A: PMN2A_1880Help
Entry
PMN2A_1880        CDS       T00267                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pmn00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PMN2A_1880
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PMN2A_1880
Enzymes [BR:pmn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     PMN2A_1880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
538431..538772
Genome map
AA seq 113 aa AA seqDB search
MPFQSTVGDYQTVATLETFGFLPPMTQDEIYDQIAYIIAQGWSPVIEHVQPSGSMQTYWS
YWKLPFFGEKDLNLVVSELEACHRAYPDHHVRIVGYDAYTQSQGTCFVVFQGR
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcctttccagagcacagtaggtgactatcaaacagtcgccaccctggaaacattcggc
ttcttaccgccgatgacccaggacgaaatctacgatcaaatcgcttatatcattgctcag
ggttggagcccggttattgagcatgttcagccaagtggttcaatgcagacttattggtct
tattggaagttacctttctttggcgagaaagatttaaatttggttgttagcgagttagaa
gcttgccatagagcatatcctgaccatcacgttcgtatcgttggatatgacgcgtataca
caaagtcaaggtacttgctttgtagttttccaaggccgctag

DBGET integrated database retrieval system