KEGG   Petrotoga mobilis: Pmob_1871Help
Entry
Pmob_1871         CDS       T00621                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
pmo  Petrotoga mobilis
Pathway
pmo00500  Starch and sucrose metabolism
pmo01100  Metabolic pathways
pmo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pmob_1871
Enzymes [BR:pmo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Pmob_1871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase MnmE_helical Glyco_transf_5
Motif
Other DBs
NCBI-ProteinID: ABX32560
JGI: Pmob1871
UniProt: A9BGX9
LinkDB All DBs
Position
2064312..2066879
Genome map
AA seq 855 aa AA seqDB search
MDFISKITVVPKIPEKILGLKELSENMWWTWNYKTQALFETIDKELWESTQRNPVTFLKR
VEQKKLNTAAEDSKFNELYQEVMKEFSNYMNENSNTWFSKTHRSFKDGEIAYFCMEYGLH
ESFPMYSGGLGILAGDHLKSASDLGIPLIAIGLLYQKGYFIQRLNSEGWQESIFLDYDFS
DFPIIPAKESNGDEIYVDIDLLGKKVFAKVWQVKVGRVNLYLLDTNLMQNDPEDREITST
LYGGDIEMRIKQEILIGIGGVKAVRKLGYNPSVWHMNEGHAAFLGLERIRELVQEHGLTF
QEAIEAVRAGNVFTTHTPVPAGNDVFSISLIDKYFGDFWPKLGASRQDFLNLGLEKRQNA
EELFSMTILALKLSGRSNAVSRLHGEVSRKLWNHVWPGIEWLEVPINYVTNGVHIDTWLN
PKLQESLKEYLGADWMSKIDDPELWEKIDNIPDHELWETHQQLKKELIEYIRKSIKAQRS
RHGETVEQLEEVNQIGDEKALTIGFARRFATYKRADLIFSDEERLKKILNDPDKPVQLIF
AGKAHPADKPGQELIKKIYEYSRKPEFQNKVIILENYDMDMARHLVSGVDIWLNNPRRPR
EASGTSGQKAGMNGAINFSVLDGWWVEGYNGKNGWAIGDNRDYEDLKLQDKIDSVSIYNQ
LEKQIVPMYYEKGETDVSKEWVSKMKESIKSVTSFFNTARMLKEYTQKLYMPALEQHTRF
SNDDFKLAKEFAGWVKLLKENWDSIKIHVKLDQDLTGVKNAEEEIGVQAEIYLPGIGPDS
ILPEVVFARLKDGKIANIRRYDMKLIKEVQKDTYLYSVKFKIEDRGEYGINVRVTPNNPL
MPHKNYLMGLVKYPQ
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atggattttataagtaaaattaccgtcgttccaaaaatcccggaaaagattctggggtta
aaagaactctctgaaaacatgtggtggacatggaattataaaactcaagccttattcgaa
accatagacaaagagctttgggagtccactcagagaaacccggttacctttttaaaacgt
gtggaacaaaaaaaattaaacactgctgcagaagattcgaaatttaacgaactctatcaa
gaagtcatgaaagagttttctaattatatgaatgaaaatagcaacacatggttcagtaag
acccaccgttcttttaaagatggagaaattgcttacttttgtatggaatatggccttcac
gagtcttttcctatgtattctggtggtttaggaatattggctggtgatcatctaaaaagt
gcaagtgatctaggtataccacttatagctataggtttactataccaaaagggatatttt
attcagaggcttaattcagaaggatggcaagaaagtatatttttagattacgatttttcg
gattttcctattattcccgccaaagaaagcaacggggatgaaatatacgtcgatatagac
ctattagggaaaaaggtattcgctaaagtttggcaggtaaaggtaggaagagtgaaccta
tacctcttggacaccaacctaatgcaaaatgatcctgaagatagagaaataacctccaca
ttgtatggtggagacatagaaatgcgtataaaacaagaaatactaatagggatcggtgga
gtgaaagcggtaagaaagttagggtacaacccatctgtttggcacatgaatgaaggtcac
gctgcattcttaggtcttgaaagaatacgtgaattagttcaagaacatggcttaactttt
caggaagcaattgaagcggttcgggctggaaacgtttttaccactcacactcccgtacct
gctgggaacgatgtattttctatttctttaattgataaatattttggagacttttggcct
aaattaggagcttcaaggcaagactttctaaatttaggattagaaaaaagacaaaacgca
gaagaattattttcaatgaccattttggcgctaaaactctctggaagatcaaatgctgtt
tcaaggctacatggagaagtatcgagaaagttatggaaccatgtttggccaggtatagaa
tggttggaagtacctataaactatgttaccaatggcgtacatatagacacatggttaaac
ccaaaattgcaggaatctttaaaagaatacctgggtgctgactggatgtcaaaaattgac
gatccagaactttgggaaaaaattgataatatccctgaccatgaactatgggaaactcac
caacaattaaaaaaagagttaatagaatacattaggaagagtataaaagcacaaagatcg
agacatggagaaacagttgaacaactcgaggaagtaaaccaaataggtgatgaaaaagct
ttaactatcggttttgccagaaggtttgctacttacaaacgggcagatctaatattcagc
gatgaagaaagattaaaaaagatcttgaacgatccagacaaacccgtacaattaatattc
gctggtaaagctcaccctgcggataaaccaggtcaagaactcataaaaaagatatacgaa
tactcacgaaaaccagaatttcaaaataaagtcataattctggaaaattacgatatggat
atggcaaggcacttagtttcgggtgttgacatttggttaaacaatcctagacgtccaaga
gaggcatctggaacatcaggccagaaagccggaatgaatggagctataaacttctcagtt
ttagatggctggtgggttgaaggatacaacggtaaaaatggatgggccataggggacaac
agagactatgaagacttgaaattacaggataaaatagacagtgtttcaatatacaaccaa
ttagaaaaacaaatagtgcctatgtactatgaaaaaggagaaactgacgtttcaaaagaa
tgggtatcaaagatgaaagagtctattaaaagtgtcacatcttttttcaacacagccaga
atgctcaaagaatacactcaaaaactatatatgcccgctctcgagcagcacacacgcttt
tcaaacgatgactttaaattggcaaaagaatttgccggttgggttaaattgttaaaagaa
aattgggactctataaaaatacatgtcaaactcgatcaagatcttactggagtaaaaaac
gcagaagaagaaataggagtacaagcagaaatatacttgccaggtataggtccagactca
atcctaccagaagttgtatttgcaaggttaaaagatggtaagattgcaaacataaggcgg
tacgatatgaaactcatcaaagaagtacaaaaagacacatatctatactcagtaaaattt
aaaatagaagacaggggggaatatggaataaatgtaagggtaacacctaacaatcctctc
atgccccataaaaactacttgatgggactagtaaaatatcctcaataa

DBGET integrated database retrieval system