KEGG   Pseudomonas monteilii SB3078: X969_25610Help
Entry
X969_25610        CDS       T02972                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pmon  Pseudomonas monteilii SB3078
Pathway
pmon00010  Glycolysis / Gluconeogenesis
pmon01100  Metabolic pathways
pmon01110  Biosynthesis of secondary metabolites
pmon01120  Microbial metabolism in diverse environments
pmon01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pmon00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    X969_25610
Enzymes [BR:pmon01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     X969_25610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AHC85206
LinkDB All DBs
Position
5483607..5484503
Genome map
AA seq 298 aa AA seqDB search
MATFQVITEQHGELNCWRISSDHAELLIAQQGAQILSYQRVGQPPLLWLSDQAIFRKGKS
VRAGVPVCWPWFGNLQRNPQAVQAMYHGEQAPAHGLARARDWQLLGIEEAGEGLRIEFEL
PEAQGDLPGWPHDVELKLVVELGEDLRLNLTSRNMGNTPVTISQALHSYFAVSDVRQARV
EGVEGLSYIETLADWEQCQQKGPLAFAGETDRIYLATPQTLSIVDPHWKRRITLTSSGSR
SAVIWNPWTERARELPDMADDGWQRMLCIETANVWDDLVELKPGGSSSLAVRIGCEMI
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggctaccttccaggtcataaccgagcaacatggcgaactcaactgttggcgtatcagc
agtgaccacgccgaactactgatcgcccagcagggcgcgcagattctcagctaccagcgc
gttggccagccaccgctgctgtggctgagcgaccaggccatcttccgtaagggcaagtcg
gtacgcgccggtgtgccggtgtgctggccgtggttcggcaacctgcagcgcaacccccag
gccgtgcaggccatgtaccacggcgaacaggcccccgcccacggcctggcgcgcgcgcgc
gactggcaattgctgggtatcgaggaggcgggcgaaggcctgcgcatcgaattcgaactg
ccggaagcgcagggtgacctgcctggctggcctcatgacgtcgagctgaagctggtagtg
gagctgggcgaggacctgcggctgaacctgaccagccgcaacatgggcaatacccccgtg
accatcagccaggccctgcacagctacttcgcggtcagtgacgttcgccaggcgcgggtc
gaaggggtggaggggctgagctatatcgagaccctggctgactgggagcagtgccagcag
aaggggccgctggcgtttgccggggagactgaccggatctacctggcgaccccgcaaacc
ctgagcatcgtcgacccgcactggaagcggcgcattaccttgaccagcagtgggtcgcgc
tcggcggtgatctggaacccttggactgaacgggccagggaactgccagacatggccgac
gatgggtggcagcggatgctgtgcatcgagacggcgaatgtgtgggatgacttggtggaa
ttgaagcctgggggcagcagctcgctggcggtcaggattggctgtgaaatgatctga

DBGET integrated database retrieval system