KEGG   Pseudomonas mosselii: O165_004255Help
Entry
O165_004255       CDS       T03276                                 

Definition
(GenBank) peptide synthase
Organism
pmos  Pseudomonas mosselii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
860525..873472
Genome map
AA seq 4315 aa AA seqDB search
MTDAFELPHSLVQALAQRAAQTPERIALRFLADAPGEQAVLSYRDLDQRARTIAAALQSQ
AGFGERAVLLFPSGPDYVAAFFGCLYAGVIAVPAYPPESSRQHHQERLLSIIDDAEPRLL
LTVKALEDSLQGLDALAGAKAPGLLAVDSLDPQLAAQWHEPVLEGSDIAFLQYTSGSTAL
PKGVQVSHGNLVANEQLIRHGFGIDLNPDDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVL
MSPGYFLARPLRWLQAISEYGGTISGGPDFAYRLCSERVSEAALAGLDLSRWRVAYSGSE
PIRQDSLDTFAEKFAACGFTASSFFASYGLAEATLFVSGSRRGQGIGGLELDAEAFAANR
AEPGQGSVLMSCGYPQPGHAVCIVDPQRLEVLEDNRVGEIWAGGPSIALGYWRNPEASAR
TFVERDGQTWLRTGDLGFMRDGEVFVTGRLKDMLIVRGQNIYPQDLEKTLEREVDVLRKG
RVAVFAVDDQGEEGIGVAVEISRNVQKAHTPEALINTLRRVIADACRQAPAVVLLLNPGA
LPKTSSGKLQRSACRLRMNDGSLDIYARFPMAQTEQGNGVAGDDLQARIAGIWRELLKVE
AVAAHDHFLLLGGNSIAATQVTARLGDELGIQLSLRTLFEAPTLAEYSAAVAAVLAEGGS
AAGTIETQARDQALPQSLAQNRLWLLWQLEPQSAAYNIPAGLHLRGELDVAALQASFQAL
VARHESLRTLFDEVDGQAVQRILPSQAFTLRHLDLEGQSPAEVAARREDEAQQPFDLRQG
PLLRVTLARLDDEEHQLWVTLHHIVADGWSLNILLDEFARLYAAQGQAVQLPELTLGYAD
YGQWQRQWLADGESARQLDYWKNKLGDELPVLDLCTDQPRASQQHSRAARHSLKVPAALT
SALKDLAREQQASLFMVLLAGWQAVLHRYSGQGDIRVGVPNANRPRLETQGMVGFFINTQ
VLRAELDGRLPFAGLLAQARQATLEAQAHQDLPFEQLLEALPQAREQGLFQVMFNHQQRD
LSALRRLPGLLAEELPWHSREAKFDLQLHSEEDHQGRLTLAFDYAAGLFEAATVKRLASH
LLALLEQVCAEPQLAIGDVRMLDEHSQTQLLEWGQAPMASAPRLLVEQLNEQARLSPERT
ALVWEGGQLGYAELHQQANRLAHYLRDKGVGPDTCVAIALERSPQLLVGLLAILKAGGAY
VPLDTDYPAERLAYMLGDCQAGLLLSHSSLLDKLPQVEGVSAIALDQLHLDSWPSQAPGL
HLHGDNLAYVIYTSGSTGQPKGVGNTHAALAERLQWMQASYALVDSDVLMQKAPISFDVS
VWECFWPLVTGCKLVLAGPGEHRDPQRIAQLIQQHAVTTLHFVPPLLQVFVQEPLAAGCT
SLRRLFSGGEALSAALRDRVLQLLPQVQLHNRYGPTETAINVTHWHCQAHDGERSPIGRP
LGNVLCRVLDDEFELTAPGVPGELCLGGAGLARGYLGRPGLTAERFVPQPDGNGARLYRS
GDRARWHVQSQALEYLGRLDQQVKVRGFRVEPEEVQAVLLAEPGVAQAQVLIHKDAVGAQ
LVGYYSGVEQTEALLAALAERLPAYMVPAQLIHLAQMPLGPNGKVDRKALPAPVWQQHEH
VEPQSALQQQVAAIWREVLGRPQVGLQDDFFALGGHSLLATQIVSRTRQALDVELPLKAL
FEASELGAFCAEIARLQGCGAHNLQGAIARVDRRQAVPLSYSQQRMWFLWQMDPHSPAYN
VGGMARFQGLLHVDAFERALQALIVRHETLRTTFPSIDGKPYQCVADDSHVQLHWHDFSS
LADEARQQRLQQLADDQAHQPFDLERGPLLRACLVKAGEREHYFVLTLHHIVTEGWAMDI
FARELGELYEAFVDERESPLAPLPVQYLDYSVWQRQWLESGEGDRQLAYWKDRLGNEHPV
LALPADRPRPAVQSHRGELYRFDLDPALVKRVHAFNSQRGLTLFMTMTATLAAMLHRYSG
QRDLRIGAPVANRIRPESEGLIGAFLNTQVLRCELDGQMSAGALLDQVRQTIIDGQSHQD
LPFEQLVEALQPPRSSAYNPLFQVMCNVQRWAFQQSRELVGMQVDYLVNDASATKFDLYL
EVTDLDGRLGCCFTYSRDLFDEPRIARMAEHWQQLLVALIDDPQQRLCELPMLAEAEQQV
LIGQLQGEQDFALDQTLHGLFAAQAERTPQALALTFAGQHLSYAELDQQANRLARALRER
GVGPQVRVGLALERSLEMVVGLLAILKAGGAYVPLDPEYPLDRLRYMIEDSRLGLLIGQR
ALLDTLGELPPGVARWSLEDDAGSLSAYSDAALDNLNLPQHQAYLIYTSGSTGKPKGVVV
SHGEIAMHCKAVIAEFGMRSDDCELHFYSINFDAASERLLVPLLCGARVVLRAQGQWGAE
EICQLVREQQVSVLGFTPSYGSQLAQYLAGQGEQLPVRLVITGGEALTGEHLQRIRQAFA
PQQFFNAYGPTETVVMPLACLAPEQIPVDAGSVPIGRVIGARTAYILDEDLALLPQGGIG
ELYVGGAGLAQGYHDRPGLSAERFVADPFSHAGGRLYRTGDLVRLRADGLVEYVGRADQQ
VKIRGFRIELGEIESRLQEHADVEEAVVLALDLPGGKQLVGYLVCPQASADGEAQALLRE
TVKADARQHLPDYMVPAHLVLLDSLPLMGNGKLDRRALPAPDLEQARQNYQAPANELEGQ
LAQIWREVLNLPRIGVQDNFFELGGDSILSIQVVSRARQLGLQFTPRDLFQHQTIQTLAA
VVTRSEAPSAIEQGARQGSAGLTPIQHWFFDSEVPQPQHWNQAVLLGVRQPLQAEALERA
LAALVQHHDSLRLRFGQANGRWQAEYAQPSTQPLLWTATVSDFDDCQALYTDVQRSLDLA
EGPLLRALLVSDDQGVQRLLLAIHHLVVDGVSWRVLLEDLQALYRGETLAAKTHAMGDWA
ARLASYAGSDSLRDELGWWEAQLGSARRELPCDHPQGGNLHRHARSLAIDLNVEQTRQLL
QQAPAAYHTQVNDLLLTALARTLCHWSGDEQVLVQLEGHGRDGLFEDMDLTRSVGWFTNA
YPLSLSPVMADGEVGRATSIKRIKEQLRHVPHKGQGYGVLRYLADELGRERMAALPQARI
TFNYLGQFDQQFDQAALFQPLDAPVGLAHDLDAPLPNWLSVDGQVYGGALQLRWSYSAER
YDEATIARLAEAYRQELLALVAHCLADGNGSFTPSDFPLAQLTQEQIDTLPIPAAEIEDV
YPLTPMQEGLLLHTLLEPGTGIYYMQDRYRINSTLDPERFAQAWQAVVARHEALRASFSW
NAGEAMLQIIHKPGKTAVDYQDWRGLDEHAQEARLQALHKEEREAGFELLREAPFHLRLV
RVDEARYWFMMSNHHILIDAWCRSLLMNDFFEIYQALGEGRQAQLPVPPRYRDYIGWLQR
QDLDEARQWWQANLAGFERATAIPSDRPLRHDHAGDGMVVGDCYTRLQVSEGARLRELAQ
AHQLTVNTFAQAAWALTLARYSGDRDVVFGVTVAGRPVSMPQMQRTVGLFINSIALRVQL
PQPGERSSVRQWLQGLLDRNMQLREYEYLPLVAIQECSELPKGQPLFDSLFVFENAPVET
AVLDHAQHLDASSDSGRTHTNFPLTAVCYPGDDLGLHLSFDQRYFDYPTVERLLAEFKRL
LLALVEGFEGEVGELPLLGADEQRFLLEDCNRTEHAYALEQSYVELFEARVAAHPQRTVA
RCETAAYDYAGLNVAANRLGHALVAAGVAIDQPVALLAERGLALLGMIVGSFKAGAGYLP
LDPGLPAARLQRIVELSRTPVLVCSAACAEQARQLLDEVAGAARPKLLVWEDVQASNVAS
HNLGIHSAPDNLAYVIYTSGSTGLPKGVMVEQRGMLNNQLSKVPYLALDEQDVIAQTASQ
SFDISVWQFLAAPLFGAKVEIVPNAIAHDPQGLLSHVQATGITVLESVPSLIQGMLANDH
QALDGLRWMLPTGEAMPPELAAQWLQRYPAIGLVNAYGPAECSDDVAFFPVDAASTQGSY
LPIGTPTDNNRLYLLGEDQTLVPLGAVGELCVAGTGVGRGYVGDPLRTAQAFIPHPYGAP
GERLYRTGDLARRRPDGVLEYVGRIDHQVKIRGYRIELGEIEARLHEQPELRDAAVGVQE
GVNGKHLVGYLVAHQGVSADAALLDQLKQRLRAELPEYMVPLHWGWFDSLPHNANGKLDR
KALPAIDIGGQHSEAYLAPRNELEETLAGIWADVLKAERVGVRDNFFELGGHSLLATQIA
SRVQKALQLNVPLRAMFECSTVQELADYVRGLQDSALDDAKVDRLSDLMAELEAL
NT seq 12948 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgccttcgaactcccgcactcgctggtccaggccttggcgcaacgcgccgcc
cagaccccggagcgcattgccttgcgcttcctggccgatgcgcccggcgagcaggcagtg
ctcagctatcgggacctcgaccagcgcgcacggaccatcgcggcggcgttgcagtcgcag
gccgggttcggcgagcgtgccgtactgctgtttcccagtgggccggactacgtcgcggcg
ttcttcggctgcctgtatgccggggtgatcgccgtgccggcctacccgccggagtcgtcg
cgtcagcaccatcaggaacgcctgctgtcgatcatcgacgacgccgaaccgcgcttgctg
ctgacggtaaaggcgctggaagacagcttgcagggtcttgacgccttggctggcgccaag
gctccgggcctgctggccgtggacagcctggatccgcagttggccgcgcaatggcacgag
ccggtgctggaaggcagcgacatcgcttttctgcaatacacctccggctccaccgcgctg
cccaagggcgtgcaggtcagtcatggcaaccttgtggccaacgaacagctgattcgccac
ggtttcggcatcgatctgaatccggacgacgtgatcgtcagctggttgccgctgtaccac
gacatgggcctgatcggtggcctgctgcagccgatcttcagtggcgtgccctgcgtgctg
atgtcgccgggctatttcctcgcccggccattgcgctggctgcaggcgatcagcgagtac
ggcggcaccatcagtggcggtccggatttcgcctaccggctgtgcagcgagcgggtcagc
gaggccgcgctcgccggcctggacctgagccgctggcgcgtggcctattcggggtccgag
ccgatccgccaggacagtctcgataccttcgctgaaaagtttgccgcctgcggcttcacc
gccagcagcttcttcgccagctatggcctggccgaggccaccctgttcgtcagcggcagc
cgccgtggccagggtatcggcgggctggagctggatgccgaggccttcgccgccaaccgc
gccgagcccggccagggcagcgtgctgatgagctgcggctacccgcagccgggccatgcg
gtgtgcattgtcgacccgcagcgcctggaggtgctggaggacaaccgggtcggcgagatc
tgggccggcggcccgagcatcgccctgggctactggcgcaaccccgaggccagcgcccgg
acctttgtcgagcgtgacggccagacctggctgcgcaccggcgatctcggcttcatgcgc
gatggcgaagtgttcgtcaccgggcgcctgaaggacatgcttatcgtccgtggccagaac
atctacccgcaggacctggaaaagaccctcgagcgtgaagtcgatgtgctgcgcaagggc
cgggtggcggtgttcgccgtcgacgatcagggcgaggagggcatcggcgtggcggtggag
atcagccgcaatgtgcagaaggcgcacacgcccgaggcgctgatcaataccctgcgccgg
gtcattgccgatgcctgtcgccaggcgccggccgtggtgttgctgctcaacccgggcgcc
ttgcccaagacctccagcggcaagctgcagcgctcggcctgccgcctgcgcatgaacgac
ggcagcctggatatctatgcgcgtttcccgatggcgcagacggagcagggcaatggcgtg
gccggtgacgacctgcaggcacggatcgcgggaatctggcgtgagctgctcaaggtcgag
gcggtggcggcgcacgatcacttcctgctgctgggcggcaactccatcgcggccacccag
gtgaccgcgcgcctgggcgacgaactgggcatccagctcagcctgcgcaccttgttcgaa
gcaccgaccctggccgaatacagcgccgccgtggcggctgtcctcgccgaaggtggcagc
gccgccggcaccatcgaaacccaggcccgcgaccaggccctgccgcagtcactggcacag
aaccgcttgtggctgttgtggcagctggagccgcagtccgccgcctacaacatccccgcc
gggctgcacctgcgcggcgagctggatgtcgcggcgctgcaggccagcttccaggccctg
gtggcacgccatgaatccttgcgcacgttgttcgacgaagtcgatggccaggccgtgcaa
cgcatcctgccgagccaggcgttcaccctgcgtcatctggacctcgaagggcagtctccc
gccgaggtggccgcgcgccgcgaggatgaggcgcagcagccgttcgatctgcgccagggc
ccgctcctgcgggtgaccctggcgcgcctggacgacgaagagcaccagctgtgggtgacc
ctgcaccacatcgtcgccgacggctggtcgctgaacatcctgctggatgagttcgctcgc
ctgtacgccgcacagggccaggccgtgcaactgcccgaactgacgctgggctacgccgac
tacggccagtggcagcgccagtggctggccgatggcgaaagcgcccgccagctcgactac
tggaagaacaagctgggtgacgaactgccggtgctcgacctgtgcaccgaccagccccgc
gccagccagcagcacagccgcgccgcgcgccacagcctcaaggtacctgcggcactgacc
agcgccctcaaggacctggcccgcgagcagcaggccagtctgttcatggtcctgctggcc
ggctggcaggccgtgctgcatcgctacagcggccagggcgacatccgcgtcggcgtgccc
aacgccaaccgcccgcgcctggaaacccaaggcatggtcggcttcttcatcaacacccag
gtgctgcgcgccgagctcgacggccgcctgccgttcgccgggctgctggcccaggcgcgc
caagccaccctggaggcccaggcccatcaggacctgcccttcgagcaactgctcgaggcg
ctgccgcaggcccgtgaacaaggcctgttccaggtcatgttcaaccaccagcaacgcgac
ctgtcggccttgcgtcgcctgcccggcctgctcgccgaagagctgccgtggcacagccgc
gaagccaagttcgacctgcagttgcacagcgaggaagaccaccagggccgcctgacgctg
gccttcgactacgccgccgggttgttcgaggcggccaccgtcaagcgactggccagccat
ctgctggccttgctcgagcaggtctgcgccgagccgcagctggccattggcgatgtgcgc
atgctcgacgagcacagccagacgcagctgctcgagtggggccaggcgcccatggcgagc
gcgccgcgcctgctggtcgagcaactcaacgaacaggcgcgcctgagccccgagcgcacc
gcgctggtgtgggagggcggtcaactgggctatgccgaactgcaccagcaggccaaccgc
ctggcgcactacctgcgcgacaagggcgtcggtccggacacttgcgtggcgattgccctg
gagcgttcgccgcagctgctggtcggcctgctggccattctcaaggccggtggcgcctac
gtgccgctggacaccgactacccggccgagcgcctggcctacatgctcggtgattgccag
gccggcctgctgctcagccacagcagcttgctcgacaaactgccgcaggtcgaaggcgtg
agcgccatcgccctcgaccagttgcacctggacagctggccaagccaggcccccggcctg
cacctgcacggcgacaacctcgcctatgtgatctacacctccggctccaccggccagccc
aagggcgtgggcaacacccatgcggcgctggccgagcgcctgcagtggatgcaggccagc
tatgcgctggttgacagcgacgtgctgatgcagaaggcgccgatcagcttcgacgtgtcg
gtgtgggagtgcttctggccgctggtcaccggttgcaagctggtcctggctggccccggc
gaacatcgcgatccgcagcgcatcgcccaactgatccagcaacacgcggtgaccacgctg
cacttcgtcccgccgttgctgcaggtgttcgtccaggagccgttggccgccggctgcacc
agcctgcgccggttgttctccggtggcgaggcgttgtccgccgcgttgcgtgaccgcgtg
ctgcaactgctgccacaggtgcaactgcacaaccgctatggtccgactgaaaccgcgatc
aacgtcacccactggcactgccaggcgcatgacggcgagcgctcgcctatcggccgcccg
ctgggtaacgtgctgtgccgggtgctggacgatgagttcgagttgaccgcgccgggcgtg
cccggcgagctgtgcctgggtggcgcgggcctggcccgcggctacctcggccgcccgggg
ctgaccgccgagcgcttcgtgccgcagcctgatggcaatggcgcacggttgtaccgcagt
ggtgaccgcgcccgctggcatgtgcagagccaggccctggagtacctggggcgcctcgac
cagcaggtcaaggtgcgcggcttccgcgtcgagccggaggaggtgcaggctgtgctgctg
gccgagccgggtgtcgcccaggcacaggtgctgatccacaaggatgccgtcggtgcccag
ctggtgggctattacagcggtgtcgagcagaccgaggcgctgctggccgcattggccgag
cgcctgccggcctacatggtgccggcacaactcatccatcttgcgcagatgcccctgggg
ccgaacggcaaggtcgatcgcaaggcgctgccggcaccggtctggcagcaacatgaacat
gtcgagccgcaaagtgcattgcaacaacaggtcgcggcgatctggcgcgaggtcctgggc
cggccgcaggtcggcttgcaggatgacttcttcgccctcggcggccactcgctgctggcc
acccagatcgtctcgcgcactcgccaggcgctggatgtcgagttgccgctcaaggccttg
ttcgaggccagcgagctgggcgcgttctgcgccgaaattgcccgtctgcagggttgcggc
gcacacaacctgcaaggtgccatcgcccgtgtcgaccgccgccaggcggtgccgctgtcg
tactcgcagcagcgcatgtggttcctctggcagatggatccgcatagccccgcctacaac
gtcggcggcatggctcgcttccagggcctgctgcatgtggatgccttcgagcgcgccctg
caggcgttgatcgtgcgtcacgaaaccctgcgcaccactttccccagcatcgacggcaag
ccttaccagtgcgtggccgatgacagccacgtgcaactgcactggcatgacttcagcagc
ctggccgacgaggcccgccagcaacgcctgcaacaactggccgatgaccaggcgcaccag
ccgttcgacctggagcgcggtccgctgttgcgcgcctgcctggtcaaggccggcgagcgc
gagcactacttcgtcctgaccctgcaccatatcgtcaccgaaggctgggccatggacatc
ttcgcccgcgaactgggcgagctgtacgaggccttcgtcgacgagcgcgagtcgccgctg
gcgccgctgccggtgcagtacctcgattacagcgtgtggcagcgccagtggctggaaagc
ggcgagggcgatcgccagctggcctactggaaggaccgcctgggcaatgagcatccggtg
ctggcgctgcccgccgatcgcccacgcccggcggtgcagagccaccgcggcgagctgtac
cgcttcgacctggatccggcgctggtcaagcgcgtgcacgccttcaacagccagcgcggc
ctgaccctgttcatgaccatgaccgccaccctggccgcgatgctgcaccgctacagcggc
cagcgcgacctgcgcatcggcgcgccggtggccaaccgcattcgcccggaaagcgagggg
ttgatcggcgccttcctcaacacccaggtgctgcgttgcgaactggacgggcagatgagc
gccggcgcgttgctcgaccaagtgcgccagaccatcatcgatggccagtcgcatcaggac
ctgccattcgagcaactggtcgaggccttgcagccgccgcgctcgagcgcttacaacccg
ctgttccaggtgatgtgcaacgtgcagcgctgggccttccagcagagccgtgaactggtg
ggcatgcaggtggattacctggtcaacgacgccagcgccaccaaattcgacctgtacctt
gaggtcaccgacctcgatggccgcctgggctgctgcttcacctacagccgcgacctgttc
gatgagccgcgcatcgcgcgcatggccgagcactggcagcagttgctggtggcgctgatc
gacgatccgcagcagcgcctgtgcgaactgccgatgctggctgaagccgagcagcaggtg
ctgatcggccagttgcagggcgagcaggacttcgcactggaccagacgctgcacgggctg
ttcgccgcccaggctgagcggaccccgcaggccctggccctgaccttcgccggccagcac
ctgagctacgccgagctcgaccagcaggccaaccgcctggcccgcgccctgcgcgagcgc
ggcgtcggcccgcaggtgcgggtaggcctggcgctggagcgatcgctggagatggtggtc
ggcctgctggccatcctcaaggccggtggcgcctacgtgccgctggacccggaatacccg
ctcgaccgcctgcgctacatgatcgaggacagccgcctgggcctgctgatcggccagcgg
gcgttgctcgacaccctgggcgaactgccgccaggcgttgcccgctggagcctggaggac
gatgccgggagcctttccgcctacagcgacgccgccctggacaacctcaacctgccgcag
caccaggcctacctgatctacacctccggttccactggcaagcccaagggcgtggtggtc
agccacggtgaaattgccatgcactgcaaggcggtgatcgccgagttcggcatgcgcagc
gacgactgcgagctgcacttctattcgatcaacttcgacgccgccagcgagcgcctgctg
gtgccgctgctgtgcggtgcccgcgtggtgttgcgtgcccagggccagtggggcgccgag
gaaatctgccagctggtgcgcgagcagcaagtcagtgtgctcggtttcaccccgagctac
ggcagccagttggcccagtacctggccgggcagggcgagcaattgccggtgcgcctggtg
atcaccggtggcgaggccttgaccggcgagcacctgcaacgcatccgccaggcctttgcg
ccgcaacagttcttcaacgcctacggcccgaccgaaacggtggtgatgccgctggcctgc
ctggcgccggagcagataccggtcgacgccggcagcgtgccgatcggccgggtcatcggt
gcccgcaccgcctatatccttgacgaggacctggcgctgctgccgcaaggtggcatcggt
gaactgtacgtcggcggtgccggcctggcccaggggtatcacgaccgtccgggcctgagc
gccgagcgtttcgttgccgacccgttcagccatgctggcggtcgcctgtaccgtaccggc
gatctggtgcgcctgcgcgccgatggcctggtggagtatgtcgggcgggccgaccagcaa
gtgaagatccgtggcttccgtatcgagctgggcgagatagagagccgcctgcaggagcac
gccgacgtcgaggaggcggtggtcctggccctcgacctgccgggcggcaagcaactggtg
ggttacctggtgtgcccacaggccagcgccgacggcgaggcccaggccctgctgcgcgag
acggtcaaggccgatgcccgccagcacctgcccgactacatggtgccggcgcacctggtg
ctgctcgacagcctgccactgatgggcaacggcaagcttgaccgccgcgcgttgccggcc
ccggatctggagcaggcgcgtcagaactaccaggccccggccaacgagctggaaggccag
ctggcgcagatctggcgtgaggtgctcaacctgccgcgcatcggcgtgcaggacaacttc
ttcgaactgggcggtgactcgatcctgtcgatccaggtggtcagccgtgcccgtcagctg
gggctgcagttcaccccgcgtgacctgttccagcaccagaccatccagaccctggcggca
gtggtgacccgcagcgaggcgccgagcgcgatcgagcagggcgcacgtcagggcagcgct
ggcctgacgccgatccagcactggttcttcgacagcgaagtaccgcagccgcagcactgg
aaccaggcggtgctactcggtgtgcgccagccgttgcaggccgaggcgctggagcgggct
ttggccgcgctggtgcaacaccacgacagcctgcgcctgcgctttggccaggccaacggc
cgctggcaggccgagtacgcccagccgagcacacagccgttgctgtggaccgcgacggtg
agcgatttcgacgactgccaggcgctgtataccgatgtgcagcgcagcctggacctggcc
gaggggccgctgctgcgcgccttgctggtcagcgatgaccagggcgtccagcgcctgctg
ctggcgatccaccacctggtggtcgatggcgtgtcctggcgcgtcctgctggaagacttg
caggcgctgtaccgcggtgaaaccctggccgccaagacccatgccatgggcgactgggcg
gcgcgcctggccagctatgccggcagcgattcgctgcgcgacgagctgggctggtgggaa
gcgcaactgggcagcgcccgtcgcgaactgccctgcgaccaccctcaaggcggcaacctg
caccgccatgcccgcagccttgccatcgacctgaacgtggaacagacccgccaactgctg
caacaggcgccggcggcctaccacacccaggtcaacgatctgctgctgactgccctggcg
cgcacactgtgccactggagcggcgacgagcaggtgctggtgcagctggaaggccatggt
cgcgatggtctgttcgaggacatggacctgacccgcagcgtcggctggttcaccaacgcc
tacccactgagcctgagccccgtaatggctgatggcgaagttggtcgcgccacgtcgatc
aagcgcatcaaggaacaactgcgccacgtgccgcacaaaggccagggctacggtgtgctg
cgctacctggccgacgagctagggcgtgagcgcatggccgccttgccccaggcccggatc
accttcaactacctcggtcagttcgaccaacagttcgaccaggcggcactgttccagccg
ctggacgccccggtgggcctggcccatgacctggatgcgccgctgccgaactggctgagc
gtcgatggccaggtctacggcggcgcactgcaactgcgctggagctacagtgccgagcgc
tatgacgaggcgaccatcgcccgtctggccgaggcctatcgccaggagctgctggccttg
gtcgcccactgcctggcggacggcaacggcagcttcactccctcggatttccccctggcg
caactgacccaggagcagatcgacacgctgccgatcccggccgccgagatcgaggacgtc
tacccgctgacgccgatgcaggaaggcctgctgctgcacaccctgctcgagccgggcacc
ggcatctactacatgcaggaccgctaccgcatcaacagcaccctcgaccccgagcgcttc
gcccaggcctggcaggcggtggtggcgcgccacgaggcgttgcgcgcctcgttcagctgg
aacgccggcgaagcgatgctgcagatcatccacaaacccggcaagaccgcggtggactac
caggactggcgcggcctcgacgagcacgcccaggaagcgcgcctgcaagcgctgcacaag
gaggagcgcgaggccggcttcgagctgctgcgcgaagcaccattccacctgcgcctggtg
cgcgtggacgaggcgcgttactggttcatgatgagcaaccaccacatcctcatcgatgcc
tggtgccgctcgctgctgatgaacgacttcttcgagatctaccaggccttgggcgaaggg
cgccaggcccagttgccggtgccgccgcgctaccgcgactacatcggctggctgcagcgc
caggacctcgacgaggcgcgccagtggtggcaggccaacctggccggcttcgagcgcgcc
acggcgattcccagcgaccgtccgctgcgccatgaccacgccggtgacggcatggtcgtg
ggtgactgctacacccgcctgcaagtgagcgagggcgcccgcctgcgtgaactggcccag
gcccaccagctgacggtcaacaccttcgcccaggcggcctgggccctgaccctggcgcgc
tacagcggcgatcgcgacgtggtgttcggtgtcaccgtggccgggcgcccggtgagcatg
ccgcagatgcagcgcacggtcggcctgttcatcaacagcatcgccctgcgcgtgcagttg
ccgcagccgggcgagcgcagcagcgtgcgccagtggctgcagggcttgctcgatcgcaac
atgcagttgcgtgaatacgagtacctgccgctggtggcaatccaggaatgcagcgaactg
cccaagggccagccgctgttcgacagcctgttcgtgttcgagaacgccccggtggaaact
gcggtgctcgaccacgcccagcacctggacgccagctccgactcgggccggacccacacc
aacttcccgctgaccgcggtgtgctacccgggcgatgacctgggcctgcacctgtcgttc
gaccagcgctacttcgactacccgaccgtcgagcgcctgctcgccgaattcaagcgcctg
ctgctggccctggtcgagggcttcgagggcgaggtcggcgagctgccactgctgggggcc
gacgaacaacgcttcctgctcgaggactgcaaccgcaccgagcatgcctatgcgctggag
cagagctacgtcgagctgttcgaggcacgggtggccgcgcatccgcagcgcaccgtcgcc
cgttgcgagacggccgcttacgactatgcgggcctgaacgtggcggccaaccggctgggt
catgccttggttgcggctggcgtggccatcgaccaaccggtggcgctgctggccgagcgc
ggcctggcgctgctgggcatgatcgtcggcagcttcaaggccggcgccggctacctgccg
ctggatccgggcctgccggcggcgcgcctgcaacgcatcgtcgagctgagccgcacgccg
gtgctggtgtgcagcgcggcctgcgccgagcaggcgcgccagctgctcgatgaagtggcg
ggcgcggcgcggccgaagctgctggtctgggaagacgtgcaggcaagcaacgtggccagc
cacaaccttggcatccacagcgctccggacaaccttgcctacgtgatctacacctccggc
tccaccggcctgcccaagggcgtgatggtcgagcagcgcggcatgctcaacaatcagctg
agcaaggtgccgtacctggccctggacgagcaggacgtaattgcccagaccgcctcgcag
agcttcgacatctcggtgtggcagttcctcgccgcgccgctgttcggggccaaggtggag
atcgtgccaaacgccatcgcccatgatccgcaaggcctgctgagccatgtgcaggccacc
ggcatcaccgtgctggagagtgtgccgtcgctgatccagggcatgctggccaacgatcac
caggcgctcgatggcctgcgctggatgctgccgaccggcgaggccatgccgcccgagctg
gccgcgcagtggctgcaacgctacccggccatcggcctggtcaacgcctacggcccggcg
gagtgctcggacgacgtggcgttcttccccgtcgatgccgcctcgacccagggcagctac
ctgccgatcggtacgccgaccgacaacaaccgcctgtacctgcttggcgaagaccagacc
ctggtgccgctgggcgcggtgggcgagctgtgcgtcgccggcaccggtgtgggccgtggc
tatgtcggcgacccgctgcgcacggcgcaggcgttcattccgcacccgtacggtgcgccg
ggcgagcgcctgtaccgtaccggcgacctggcccggcgacgtccggatggcgtgctcgag
tacgtcggtcgcatcgaccatcaggtgaagatccgtggctatcgtatcgagctgggcgag
atcgaggcgcgcctgcacgaacagccagagctgcgcgatgccgcggtgggggtgcaggaa
ggcgtcaacggcaagcatctggttggctacctggtggcgcaccagggcgtcagtgccgac
gccgcgctgctcgaccagctcaagcagcgcctgcgcgccgagttgccggagtacatggtg
ccgctgcactggggctggttcgacagcctgccgcacaacgccaacggcaagcttgaccgc
aaggcgctgccggccatcgacatcggtggccaacacagcgaggcctacctggcgccgcgc
aacgagcttgaagagaccctggccggcatctgggccgatgtgctcaaggccgagcgggtg
ggtgtgcgcgacaacttcttcgagctgggcgggcattcgctgctggcaacgcagatcgca
tcgcgggtgcagaaggccctgcagttgaacgtgccgctgcgggcgatgttcgagtgcagt
acggtgcaagagctggcggactatgtgcgcgggctgcaggacagcgcgctggatgacgcc
aaggtcgataggttgagcgacctgatggcggagctggaggcgttgtaa

DBGET integrated database retrieval system