KEGG   Pseudomonas mosselii: O165_028615Help
Entry
O165_028615       CDS       T03276                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pmos  Pseudomonas mosselii
Pathway
pmos00473  D-Alanine metabolism
pmos00550  Peptidoglycan biosynthesis
pmos01100  Metabolic pathways
pmos01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pmos00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    O165_028615
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    O165_028615
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    O165_028615
Enzymes [BR:pmos01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     O165_028615
Peptidoglycan biosynthesis and degradation proteins [BR:pmos01011]
 Precursor biosynthesis
  Amino acid ligase
   O165_028615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATPgrasp_Ter ATP-grasp_4 ATP-grasp ATP-grasp_3 RimK ATPgrasp_YheCD ATP-grasp_5 GARS_A TTL TUTF7_u4
Motif
Other DBs
NCBI-ProteinID: AIN62096
UniProt: A0A088NV32
LinkDB All DBs
Position
6155730..6156686
Genome map
AA seq 318 aa AA seqDB search
MTSAYDKLHSTLDVKAFGRVAVLYGGKSAEREVSLKSGKAVIEALTSAGVDVVAIDVGDD
LLTRLQSEKIDRAFIILHGRGGEDGSMQGLLECLGIPYTGSGILASALAMDKLRTKQVWQ
SLGIPTPRHAVLASEQDCVAASAELGFPLIVKPAHEGSSIGMAKVSSEQELVAAWKDAAN
YDSQVLVEQWIHGPEFTIAVLRGQVLPPIALGTPHVFYDYDAKYIANDTQYRIPCGLDSV
KEQELIDLTARACDAVGIEGWGRLDVMQDEQGRFWLLEVNTAPGMTDHSLVPMAARAAGL
DFQQLVLAILADSVATRG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcgcctacgacaagttgcactcgaccctggacgtcaaggcctttggccgcgtc
gccgtgctgtacggtggcaagagtgccgagcgtgaggtttccctgaagtcgggcaaggca
gtgatcgaggcgctgaccagcgctggtgtcgacgtagtcgccatcgacgtcggcgacgac
ctgctgacccgcctgcagagcgagaagatcgaccgcgccttcatcatcctccacggccgt
ggcggtgaggacggcagcatgcagggcctgctcgaatgcctggggattccctacaccggc
agcggcatcctcgcctcggcgctggccatggacaagctgcgcaccaagcaggtgtggcag
agcctgggtatccccacgccgcgtcacgccgtgctggccagcgagcaggattgcgtggcc
gccagtgcggaactgggcttcccgttgatcgtcaaacccgcccatgaaggttcgagcatc
ggcatggccaaggtgagcagcgagcaagagctggtcgccgcctggaaagacgctgccaac
tacgattcgcaagtgctggtcgagcagtggatccacggtccggagttcaccatcgccgtg
ctgcgtggccaggtgctgccgccgatcgcgctgggcacccctcacgtgttctacgactac
gacgccaagtacatcgccaatgacacccagtaccgcatcccgtgcggcctggacagcgtc
aaggagcaggagctgatcgaccttaccgcgcgcgcctgcgatgccgttggtatcgagggc
tggggccgtctggacgtgatgcaggacgagcagggccgtttctggctgctcgaggtcaac
actgcaccgggcatgaccgaccatagcctggtgcccatggcggcccgtgccgccggcctg
gacttccagcagctggtgctggcgatcctggccgacagcgtagcgacgagaggttaa

DBGET integrated database retrieval system