KEGG   Pseudomonas monteilii SB3101: X970_17060Help
Entry
X970_17060        CDS       T02973                                 

Definition
(GenBank) peptide synthase
Organism
pmot  Pseudomonas monteilii SB3101
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3616046..3628999)
Genome map
AA seq 4317 aa AA seqDB search
MTDAFELPLSLVQALAQRAVQTPDKVALRFLADAPGEQAVLSYRDLDQRARTIAAALQSR
AGFGDRAVLLFPSGPDYVAAFFGCLYAGVIAVPAYPPESARQHHQQRLLSIIDDAEPRLL
LTVAALHDSLQGLEALTAANAPELLAVDGLDPALAANWREPALKGDDIAFLQYTSGSTAL
PKGVQVSHGNLVANEQLIRQGFGIDLNPDDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVL
MSPGYFLARPLRWLQAISEYGGTISGGPDFAYRLCSERVSEASLAGLDLSRWRVAYSGSE
PIRQDSLAAFADKFQACGFDPQSFFASYGLAEATLFVSGSRRGQGIAALELDAEAFAANR
AEPGKGSVLMSCGYPQPGHAVRIVEPQRLQVLGDNQVGEIWAAGPSIALGYWRNPEASAR
TFVEMGGQTWLRTGDLGFMREGEVFVTGRLKDMLIVRGQNLYPQDLEKTLEREVEVLRKG
RVAVFAVEQQGEEGIGVAVEISRNVQKAIKPQELIKTLRQVVADACRQAPAVVLLLNPGA
LPKTSSGKLQRSACRLRMDDGSLDCYARFPEVGEPVASVGEGDELQARIAGVWRDILKVE
AVAADDHFLLLGGNSIAATHATARLADELGIELGLRTLFEAPILADYAKAVAAIIAEGGD
RVGAIATLERTQALPQSLAQNRLWLLWQLDPQSAAYNIPAGLQLRGELDENALEAAFQAL
VARHESLRTLFAEENGQALQRIQAQQPFDLRRLDLEGQAAAQVAAQRETEARQPFDLTRG
PLLRVTLARLDYEHHQLWVTLHHIVADGWSLNILLDELAKLYAAHCQGLEANLAPLTLGY
ADYGSWQRQWLAAGEAERQLQHWKERLGDELPVLDLCTDHPRASQRDHRAARFNLKVPAR
LTEALKGLAREQQASLFMVLLAGWQALLHRYSGQADIRVGVPNANRPRLETQGMVGFFIN
TQVLRAQLDGRLPFDQLLAQVRQATLDAQANQDLPFEQLLEALPEAREQGLFQVMFNHQQ
RDLSALRRLPGLLAEELPWHSREAKFDLQLHSEEDHQGRLSLAFDYAAELFDASTVKRLA
QHLLALLEQVCAGPQRALGEVQLLDEPGRAQLLSWGEAPAAAPQRLLVEQLNEQARLTPQ
RTALVWDGGSLDYAELHQQANRLAHYLRDKGVGPDTCVAIAIERSPQLLVGLLAILKAGG
AYVPLDVDYPAERLAYMLADCNAGLLLSHSSLLGKLPQVDGVSAIALDQLHLDSWPSHAP
GLHLHGDNLAYVIYTSGSTGQPKGVGNTHAALAERLQWMQASYVLDDSDVLMQKAPISFD
VSVWECFWPLVTGCKLVLAGPGEHRDPQRIAALVQAHGVTTLHFVPPLLQVFVQEPQAGA
CGSLRRLFSGGEALSAALRDRVLQVLPQVQLHNRYGPTETAINVTHWHCQSTDGERSPIG
RPLGNVLCRVLDDELELTAPGVPGELYLGGAGLARGYLGRPGLTAERFVPRADGNGERLY
RSGDRARWQVQTEALEYLGRLDQQVKVRGFRVEPEEVQACLLAQPGVEQALVLIHKDAIG
AQLLGYYSGSAQPDALLTVLAEQLPAYMVPAQLIPLAQMPLGPSGKVDRKALPAPVWQQR
QHVEPQTELQQQVAAIWREVLNLPRIGLQDDFFALGGHSLLATQIVSRTRQACDVELPLK
ALFDASELGAFCAEITRIRAAGERNLQGVITRVDRRQAVPLSYSQQRMWFLWQMEPGSPA
YNVGGMARLRGTLHVDAFERALQALVVRHETLRTTFPSIDGVPYQCVAEDSSLHLDWQDF
SALPADARQQRLQQLADDQAHQPFDLERGPLLRACLVKAEEREHFFVLTLHHIVTEGWAM
DIFARELGELYEAFVDDRESPLAPLPVQYLDYSVWQRQWLESGEGARQLAYWQARLGDEH
PVLALPADRPRPAVQSHRGELYRFELDPALVARVHAFNSQRGLTLFMTMTATLAALLHRY
SGQRDLRIGAPVANRIRPESEGLIGAFLNTQVLRCELDGQMSAAQLLEQVRQVAIEGQSH
QDLPFDQLVEALQPPRSSAYNPLFQVMCNVQRWAFQQSRQLAGMQVDYLVNDASATKFDL
YLEVTDLDGRLGCCLTYSRDLFDEPRIARMAEHWQQLLVGLLDNPQQRLCELPMLSSAEQ
QVLAGQLQGEQGLALDQTVHGLFAAQAARTLHAGALTFAGRHMTYAELDQQANRLARALR
ERGVGPQVRVGLALERSLEMVVGLLAILKAGGAYVPLDPEYPLDRLRYMIEDSRIGLLLS
QRALLQTLGQLPEGVAHWSLEDDSASLSAYSDAPLGNLNLPQHQAYLIYTSGSTGKPKGV
VVSHGEFAMHCQAVIDAFGMRSDDCELHFYSINFDAASERLWVPLLCGARVVLRAQGQWG
AEDICQLVREQQVSILGFTPSYGSQLAQYLAGQGEQLPVRLVITGGEALTGEHLQRIRQA
FAPQQFFNAYGPTETVVMPLACLAPQTLPAELGSVPIGRVIGSRTAYILDEDLALLPQGG
IGELYVGGAGLAQGYHDRPGLSAERFVADPFGSEGGRLYRTGDLVRLGSDGLVEYVGRAD
QQVKIRGFRIELGEIESRLQAHADVDEAVVLALDLPGGKQLVGYLVCGQAAADSEAQGML
RDAVKADARKHLPDYMVPAHLVLLDSLPLMGNGKLDRRALPLPDLEQARQQYQAPGNEVE
AQLAQIWRDVLNIARIGVQDNFFELGGDSILSIQVVSRARQAGLQFTPRDLFQHQTIQTL
AAIVQRSEAASSIEQGLRQGQAGLTPIQHWFFDSEVPQPQHWNQAVLLEARKPLDERVLK
RALADLVQHHDSLRLRFGQAQGRWQAEYASPASGQLLWTATIADFADCQPLYTDLQRSLD
LEQGPLLRVLLVNDGQGGQRLLLAIHHLVVDGVSWRVLLEDLQALYRGQPLPAKTHAMGD
WAARLASYAGSDSLRDELGWWQGQLGGVRRELPCDHPQGGNLHRHARTLAIGLDVAQTRQ
LLQQAPAAYHTQVNDLLLTALARALCRWSGDEEVLVQLEGHGRDGLFEDMDLTRSVGWFT
NAYPLSLRPLPGEDDAARAGSIKRIKEQLRQVPHKGLGYGVLRYLADTAVREQMAALPQA
RITFNYLGQFDQQFDSTALFRPLDAPAGLAHDLDAPLPNWLSVDGQVYGGALQLRWTFSA
ERYDERTIACLAEAYRQELLALVEHCLADGNGSFTPSDFPLAHLTQAQIDALPVPAAQIE
DVYPLTPMQEGMLLHTLLEPGTGLYYMQDRYRINSALDPERFAQAWQAVVARHEALRASF
SWNTGEAMLQIIHKPGNMPVDYQDWRGLDDDAQEQRLQALHKQEREAGFALLSEAPFHLR
LVRVADERYWFMMSNHHILIDAWCRSLLMNDFFEIYQALGEGRQARLPVPPRYRDYIGWL
QRQGLDDARAWWQANLAGFERATPIPSDRPLRHDHAGSGMIVGDCYTRLAVSDGVRLREL
AQAHQLTVNTFAQAAWALVLARYSGDRDVAFGVTVAGRPVSMPQMQRTVGLFINSVALRV
QLPVAGERCSVRQWLQGLLERNMELREYEYLPLVAIQECSELPKGQPLFDSLFVFENAPV
ETAVLDHAQHLNASSDSGRTHTNFPLTAVCYPGDDLGLHLSFDQRYFDYPTVERLLAEFK
RLLLALVQGFEGEMSALPLLGAEEQRFLLEDCNRTARAYPLEQSYIAQFEAQVAAHPQRT
VARCLDASYDYAGLNLAANRLGHALIAAGVNVDQPVALLAERGLPLLGMIVGSFKAGAGY
LPLDPGLPAARLQSIIQLSRTPVLVCSAACAGQGRQLLDQLALAARPQLLVWEDIQASPV
VSHNPGIHSGPDNLAYVIYTSGSTGLPKGVMVEQRGMLNNQLSKVPYLALGEHDVIAQTA
SQSFDISVWQFLAAPLFGARVEIVPNAIAHDPQGLLAHVQATGISVLESVPSLIQGMLAN
DHQALDGLRWMLPTGEAMPPELAAQWLQRYPQIGLVNAYGPAECSDDVAFFRVDAASTRG
SYLPIGTPTDNNRLYLFGEDQALVPLGATGELCVAGTGVGRGYVGDPVRTALAFIPHPHG
APGERLYRTGDLARQRPDGVLEYVGRIDHQVKIRGYRIELGEIEARLHEQPEIRDAAVGV
QEGVNGKHLVGYLVAHQGVAADAALLEQLKLRLRAELPEYMVPLHWGWFDSLPHNANGKL
DRKALPAIDIGGQHSQAYQAPRNELEEVLAGIWADVLKADRVGVHDNFFELGGHSLLATQ
IASRVQKQLQLNVPLRAMFECSTVEELAVYVQGLQGSVLDDDKVDRLSDLMAELEGL
NT seq 12954 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgccttcgaactcccgctctcgctggtccaggccctggcgcagcgcgccgtg
cagaccccggacaaagtcgccttgcgctttctggccgacgctcccggcgagcaggccgtg
ctcagctaccgggacctcgaccagcgcgcacgcaccatcgctgctgccttgcaaagccgg
gccggtttcggcgaccgcgcagtgctgttgttccccagcgggccagactatgtggcggca
ttcttcggctgcctgtatgccggtgtgattgcggtgccggcctacccgccggagtccgcg
cgccagcaccaccagcagcgcttactgtcgatcatcgacgacgccgagccgcgcctgctg
ctgactgtcgcggccctgcacgacagcctgcagggcctggaagccctgacagcggccaac
gcccccgaactgctggcggtggatggcctggacccggcactggctgcaaactggcgcgaa
cccgcgctcaagggtgatgacatcgccttcctgcaatacacctccggctccacagcactg
cccaagggcgtgcaggtcagccatggcaacctggtggccaacgaacaactgatccgccaa
ggctttggcatcgacctcaaccccgacgacgtgatcgtcagctggctgccgctgtaccac
gacatgggcctgatcggcggcctgctgcagccgatcttcagcggcgtgccctgtgtgctg
atgtcgccgggctacttcctggcccggccgctgcgctggttgcaggccatcagcgagtac
ggcggcaccatcagcggcggccccgacttcgcctaccggttgtgcagcgagcgggtcagc
gaggcctccctggccgggctcgacctcagccgctggcgggtggcctattctggctccgag
ccgatccgccaggacagcctggcggcctttgccgacaagttccaggcctgcggcttcgac
ccgcagagcttcttcgccagctacggcctggccgaggcgaccctgttcgtcagcggcagc
cgccgtggccagggcatcgccgcgctggagctggacgccgaagccttcgccgccaaccgt
gcggagccaggcaagggcagtgtgctgatgagctgtggctacccgcagcccgggcatgcc
gtgcgcattgtcgaaccacaacgcctgcaagtactaggcgacaaccaggtgggcgagatc
tgggccgccggcccgagcatcgccctgggctactggcgcaaccccgaggccagcgcccgc
accttcgtcgagatgggcggccagacctggctgcgtaccggcgacctgggcttcatgcgc
gaaggggaagtgttcgtcaccggtcgcctgaaggacatgctgatcgtgcgcgggcagaac
ctgtacccgcaggacctggaaaagaccctcgagcgcgaagtggaggtgctgcgcaaaggc
cgggtggcagtgttcgccgtcgagcagcaaggcgaggagggtattggcgtggcggtggaa
atcagccgcaacgtgcagaaggcgatcaagccccaggagctgatcaagaccctgcgccag
gtggttgccgacgcctgccgccaggccccggccgtggtcctgctgctgaacccgggggcg
ctacccaagacctccagcggcaagctgcagcgttcggcctgccgcctgcgcatggacgat
ggcagcctggactgctatgcccgcttccctgaggtgggcgagcccgttgcttcagtgggc
gaaggcgatgaactgcaggcacgcatcgccggtgtgtggcgcgacatcctcaaggtcgag
gcggtggcggcggacgaccacttcctgctgctgggcggcaactccatcgccgccacccac
gccaccgcacgcctggccgatgaactgggcatcgagctgggcctgcgcaccctgttcgaa
gcgccgatactggctgactacgccaaggccgtggccgcgatcatcgccgaaggcggtgac
cgggtcggtgccatcgctacactggaacgcacccaggcgctgccccagtcgctggcgcaa
aaccgcctgtggttgctgtggcagttggacccgcagtcggcggcctacaacattccggcc
ggcctgcagttgcgcggtgagctggacgaaaacgcactggaagcagccttccaggcgctg
gtggcgcgccatgaatcgctgcgcaccctgtttgccgaagagaacggccaggccctgcag
cgcatccaggcgcagcagccgttcgaccttcgccgcctggacctcgaaggccaggccgcc
gcacaggtcgccgcccaacgtgaaaccgaagctcgccagccgtttgacctgacccggggg
ccgttgctgcgggtgaccctggcgcgcctggattatgagcaccatcaactgtgggttacc
ctgcaccatatcgtcgccgacggctggtcgctgaacatcctgctcgacgagttagccaaa
ctgtacgccgcccactgccagggcctcgaggccaacctggcaccgctgaccctgggttat
gccgactacggaagctggcagcgacagtggctggccgcaggcgaagccgagcgccaactg
cagcactggaaggagcgcctgggggatgaactgccggtgctcgacctgtgtaccgaccac
ccgcgcgccagccagcgcgaccaccgcgccgctcgcttcaacctcaaggtaccggccagg
ctcaccgaagcgctcaagggactggcccgcgaacagcaggccagcctgttcatggtactg
ctggccggatggcaggcgctgttgcaccgctacagtggccaggccgatattcgtgtcggc
gtgcccaacgccaaccgcccgcgcctggaaacccaaggcatggtcggcttcttcatcaac
acccaggtgctgcgtgcgcagctcgacggccgcctgccgttcgaccagttgctggcccag
gtgcgccaggccaccctggatgcccaggccaaccaggacctgccgttcgagcaactgctc
gaagccctgcccgaggctcgcgagcaaggcctgttccaggtcatgttcaatcaccagcaa
cgtgacctgtctgcgctgcgccgcctgccgggcctgctggccgaagagctgccgtggcac
agtcgcgaagccaagttcgacttgcagctgcacagtgaagaagaccaccagggccgcctg
agcctggccttcgactatgccgccgaattgttcgatgccagtaccgtcaagcgtctggcc
cagcacctgttggccctgctcgagcaggtgtgtgccgggccgcagcgggcgctgggcgag
gtgcaactgctcgacgagcctggccgcgcgcaactgctgagctggggcgaggcacccgct
gcggcgccgcagcgcctgctggtcgagcagctcaatgaacaggcacgcctgacccctcag
cgcaccgccctggtgtgggacggtggcagcctggattacgccgagttgcaccagcaagcc
aaccgtctggcccactacctgcgtgacaaaggcgtgggcccagacacttgcgtggccatc
gccatcgagcgttcgccgcagctgctggtgggcctgctggccattctcaaggccggtggt
gcctatgtgccgctggacgtcgattacccggccgagcgcctggcctacatgctcgccgac
tgcaacgctggcctgttgctgagccacagcagcctgctgggcaagctgccacaggttgat
ggcgtcagcgccatcgcactcgaccagctgcacctggacagctggccaagccatgccccc
gggttgcatctgcatggcgacaacctggcctatgtgatctacacctccggctctaccggc
cagcccaagggcgtgggcaatacccacgcggcactggccgagcgcctgcaatggatgcag
gccagctatgtgctggacgacagcgacgtgctgatgcagaaggcgccgatcagcttcgac
gtttcggtgtgggaatgcttctggccactggtgaccggttgcaagctggtgctcgccggc
cctggcgagcaccgcgacccgcagcgcatcgccgcgttggtgcaggcccatggcgtgacc
acgctgcacttcgtgccgccgctgttgcaggtgttcgtccaggagccgcaggcgggtgcc
tgcggcagcctgcgccggctgttctccggtggcgaagcgctgtccgcggcactgcgtgac
cgcgtgctgcaggtgctgccacaggtgcagttgcacaaccgctatggcccgaccgaaacc
gccatcaacgtcacccattggcactgccagtccaccgatggcgaacgctcgccgatcggc
cgcccgctgggcaatgtgctgtgccgtgtgctggacgacgagctggaactgaccgccccc
ggtgtgcccggcgagctgtacctcggcggtgcaggcctggcccgtggctacctgggccgc
ccgggcctcaccgccgagcgcttcgtgccccgggctgacggcaatggcgagcgcctgtac
cgcagtggcgaccgcgcccgctggcaggtgcagaccgaggcgctggaataccttggccgc
ctagaccagcaggtcaaggtgcgtggcttccgtgtcgaacccgaggaagtccaggcctgc
ctgctggcgcagccgggggtcgaacaggcgctggtgctgattcacaaggatgccataggc
gcgcaactgctcggctactacagtggcagcgcccagcctgatgcattgctgacggtgctg
gctgagcaactaccggcctacatggtgccggcacaactcatcccgctggcgcagatgcca
ctgggccccagcggcaaggtcgaccgcaaggcgttgccggccccagtgtggcagcagcgg
cagcacgtggagccgcaaaccgagttgcagcagcaggtcgccgccatctggcgcgaggtg
ctgaacttgccgcgcatcggcctgcaggacgacttcttcgccctcggcggccattcgctg
ctggccactcagattgtctcgcgcacgcgtcaggcctgcgatgtcgaactgccgctcaag
gccctgttcgacgccagcgagctgggcgccttctgtgccgagatcacgcgtattcgtgct
gccggtgagcgcaacctgcaaggcgtaatcacccgcgtcgatcgccgccaggcggtgccg
ctgtcgtactcgcagcagcgcatgtggttcctctggcaaatggagccgggcagcccggcg
tacaacgtcggcggcatggcgcgcttgcgcggcaccctgcatgtggatgctttcgagcga
gcgttgcaggcgctggtggtgcgccacgaaaccctgcgcaccaccttccccagcatcgat
ggcgtgccgtatcagtgcgtggccgaagacagcagcctgcacctcgactggcaagacttc
agcgccttgcccgcagatgcccgccaacaacgcctgcagcaactggccgacgaccaggcg
caccagccgttcgacctggagcgcggcccgctgctgcgtgcctgcctggtcaaagccgaa
gagcgcgagcatttcttcgtgctgaccctgcaccatatcgtcaccgagggctgggccatg
gacatcttcgcccgcgaactgggcgagctgtacgaggccttcgtcgatgaccgcgaatcg
ccgctggcgccgctgccggtgcagtacctggactacagcgtgtggcaacggcaatggctg
gaaagcggcgagggcgcccgccagctggcctactggcaggcccgcctgggcgatgagcac
ccggtgctggcgttgcctgccgaccgcccgcgcccggcagtgcagagccaccgtggcgag
ctgtaccgcttcgagctcgacccggcgctggttgcccgcgtgcatgccttcaacagccag
cgcggcctgaccctgttcatgaccatgactgccaccctggccgccttgctgcaccgctac
agcggccagcgtgacctgcgcattggcgcgccggtggccaaccgcatccgcccggaaagc
gaagggctgattggcgcgttcctcaacacccaggtgctgcgttgcgagctggacggccag
atgagcgccgcacagttgctggagcaggtacgccaggttgccatcgaaggccagtcgcac
caggacctgccgttcgaccaactggtggaagccctgcagccaccgcgcagcagcgcctac
aacccgctgttccaggtgatgtgcaacgttcagcgctgggccttccagcaaagccgccag
cttgccggcatgcaggtggattacctggtcaacgacgccagcgccaccaagttcgacctg
tacctggaggtgaccgacctcgacggccgcctgggttgctgcctgacctatagccgtgat
ctgttcgacgaaccacgcatcgcacgcatggccgagcactggcagcaattgctggtgggc
ctgctcgacaacccgcaacagcgcctgtgcgagctgccgatgctgagcagcgccgagcag
caggtgctggctggccagttgcagggcgagcagggtctcgctctcgaccagaccgtgcac
ggcctgttcgccgcccaggctgcgcgcacgctacacgctggcgcgttgacgtttgccggc
cggcacatgacctatgccgaactcgaccagcaggccaaccgcctggcccgcgccctgcgc
gagcgtggcgtcggcccgcaggtgcgtgtgggcctggcgctggagcgttcgctggaaatg
gtcgtcggcctgctggccatcctcaaggccggtggcgcctatgtgccgctcgaccccgaa
tacccgctcgaccgcctgcgctacatgattgaagacagccgcatcggcctgctgctcagc
cagcgcgcgctgctgcaaaccctcgggcagttgcccgaaggcgtggcgcactggagcctg
gaggacgacagcgccagcctgtcggcctacagcgatgcgccgctgggcaacctcaaccta
ccgcagcaccaggcctacctgatctacacctccggttccaccggcaagcccaagggcgtg
gtggtcagccacggcgagttcgccatgcattgccaggcggtgatcgacgcgttcggcatg
cgcagcgatgactgcgagctgcacttctattcgatcaatttcgacgccgccagcgaacgc
ctgtgggtgccgctgctgtgtggcgcccgtgtggtgctgcgtgcccaggggcagtggggt
gccgaagacatctgccagctggtgcgcgagcagcaggtgagcatcctcggcttcacgcca
agctacggcagccagttggcccagtacctggccgggcagggcgagcagttgccagtgcgc
ctggtcattaccggtggtgaggcgctgaccggcgaacacttgcagcgcatccgccaagcc
ttcgcgccgcagcagttcttcaacgcctacgggccgaccgaaaccgtggtcatgccgctg
gcctgcctggcaccacagacactgccggcggagctgggcagcgtgccgatcggccgtgtc
atcggtagccgcacggcctacatcctcgacgaagaccttgccctgttgccgcaaggcggt
attggcgagctgtatgtcggcggtgccggcctggcccagggttaccacgaccgcccgggc
ctaagcgccgagcgcttcgtcgccgacccgttcggcagcgaaggcgggcgcctgtatcgc
accggtgacctggtgcgcctgggcagcgatggcctggtcgagtacgtcggccgcgccgac
cagcaggtgaagattcgcggtttccgtatcgagctgggcgaaatcgaaagccgcctgcag
gcgcatgccgatgtcgacgaagctgtggtgctggccctcgacctgccaggtggcaagcaa
ctggtgggttacctggtgtgcgggcaagccgctgccgacagcgaggcccagggcatgctg
cgcgacgcggtgaaagccgatgcccgcaagcacttgccggactacatggtgccggcgcac
ttggtgctgctcgacagcctgccgctgatgggcaacggcaagctcgaccgccgtgcgctg
ccgctgccggacctggaacaggcacgccagcagtaccaggcgcctggcaacgaggtggaa
gcgcaactggcgcagatctggcgcgacgtgctcaacattgcccggatcggcgtgcaggac
aacttcttcgaactgggcggcgactcgatcctgtcgatccaggtggtcagccgtgctcgt
caggccggcttgcagttcaccccgcgcgacctgttccagcatcagaccatccagaccctg
gccgccatcgttcagcgcagcgaagccgccagcagcatcgaacagggcctgcgccagggc
caggccggcctcacgccgatccagcactggttcttcgacagtgaagtgccacagccgcag
cactggaaccaggctgttctgctggaggcacgcaagccgctggatgagagggtactgaag
cgagccttggccgacctggtgcagcaccacgacagcctgcgcctgcgctttggccaggcc
cagggccgctggcaggccgaatatgcttcgcctgccagcgggcagttactgtggacagcc
acgatcgccgacttcgccgattgccaaccgctgtacaccgacctgcaacgcagcctcgac
ctggaacagggcccactgttgcgcgtcttgctggtaaatgacggccagggcggccagcgc
ctgttgctggctatccatcacctggtggttgatggcgtgtcgtggcgcgtgctgctggaa
gacctgcaagcgctataccgcggccagccgctgccggccaagacccacgccatgggcgac
tgggccgcacgcctggccagctatgctggcagcgattcgctgcgcgacgagctgggctgg
tggcaaggccagttgggtggtgtgcgccgtgaactgccatgtgatcacccgcagggcggc
aacctgcaccgccacgcccgtaccctggccatcggcctggatgtggcgcagacccggcag
ttgctgcagcaggccccggcggcctatcacacccaggtcaacgacctgctgctgaccgcg
ctggcgcgtgccctgtgccgctggagcggcgatgaagaagtgctggtacagcttgagggc
catggccgtgacgggctgttcgaagacatggacctgacccgcagcgtcggctggttcacc
aacgcctacccgctgagcctgcgcccgctgccaggcgaggacgatgcggcgcgggcaggc
tcgatcaagcgcatcaaggagcagctgcgccaggtgccgcacaaagggctgggttacggc
gtgctgcgctacctggccgatacggcagtgcgtgagcagatggcggccctgccgcaggca
cgcatcaccttcaactacctgggccagttcgaccagcagttcgacagcacagccctgttc
cggccgctggacgccccggccggcctggcccacgacctcgatgcaccgctgcccaactgg
ctgagtgtcgatggccaggtgtatggcggtgccctgcaactgcgctggaccttcagtgcc
gaacgctacgacgagcggaccatcgcctgcctggccgaggcctatcgtcaggagctgctg
gcgctggtcgagcattgcctggctgatggcaacggcagtttcacgccatcggacttcccg
ctggcgcacctgacccaggcgcagatcgacgcgctgccggtaccggcagcgcagatcgag
gacgtctacccgctgacgccgatgcaggagggcatgttgctgcacaccctgctggagccg
ggtactggcctctactacatgcaggaccgctaccgcatcaacagcgcgctcgaccccgaa
cgcttcgcccaggcgtggcaggcggtggtggcacgccacgaggcgctacgcgcatcgttc
agctggaacaccggcgaggcgatgctgcagatcatccacaaaccgggcaacatgccggtg
gactatcaggactggcgtggcctcgacgatgacgcccaggagcagcgcctgcaggccctg
cacaagcaggaacgcgaggctggtttcgccctgctcagcgaggcgccgttccacctgcgc
ctggtgcgtgtggccgacgagcgctattggttcatgatgagcaaccaccacatcctcatc
gatgcctggtgccgttcgctgctgatgaacgatttcttcgagatctaccaggccctcggc
gaggggcgccaggcccgcttgccggtgccaccgcgctaccgcgactacatcggctggctg
caacgccagggcctggacgacgcgcgagcctggtggcaggccaacctggccggcttcgaa
cgtgccacccccatccccagcgaccgcccgctgcgccacgaccatgccggtagcggcatg
atcgtcggcgactgttacacccgcctggcggtgagcgacggcgtgcgcctgcgcgaactg
gcccaggcccaccagctcaccgtcaacaccttcgcccaggcggcctgggcactggtgctg
gcgcgctacagtggcgaccgcgacgtggcctttggcgtgaccgtggccgggcgcccggtg
agcatgccgcagatgcagcgtaccgttggcctgttcatcaacagcgtcgccctgcgcgtg
caattgccggtggcgggtgagcgctgcagtgtgcggcagtggttgcaaggcctgttggag
cgcaacatggagctgcgcgagtatgaatacctgccgctggtggcgatccaggaatgcagc
gaactgcccaagggccagccgctgttcgacagcctgttcgtgttcgagaacgcgccggtg
gaaactgccgtgctcgaccacgcccagcacctgaatgccagctccgactcgggccgtacc
cacaccaacttcccactgacagcggtgtgctacccgggcgatgaccttggcctgcacctg
tcgttcgaccagcgctatttcgactacccgaccgtcgagcgcctgctggccgagttcaag
cgcctgctgctggcgctggtgcaaggctttgaaggggagatgagcgcactgccgttgctg
ggtgcggaagagcagcgcttcctgctggaagactgcaaccgcaccgcgcgcgcctatccg
ttggaacagagttacatcgcgcagttcgaggcgcaggtggccgcgcatccgcaacgtacc
gtggcccgctgcctggacgcgtcctacgactacgccggcttgaacctggcggccaaccgt
ctgggccatgccttgatcgcggcgggtgtgaacgtggaccagccggtggcactgctggcc
gagcgtgggctaccgctgctgggcatgatcgtcggcagcttcaaggccggcgccggctac
ctgccactggacccgggcctgccggcggcgcgcctgcaaagcatcatccagctcagccgt
acacccgtgctggtgtgcagcgcggcctgtgccgggcaagggcggcagttgctggaccag
cttgcgttggcggcacggccgcagctgctggtctgggaagacatccaggccagcccggtg
gtcagccacaaccccggcattcacagcgggccggataacctcgcctatgtgatctacacc
tcaggctccaccggcctgccgaagggggtgatggtcgagcagcgcggcatgctcaacaac
cagctgagcaaggtgccgtacctggcgcttggcgagcacgacgtgatcgcccagacggcc
tcgcagagcttcgacatttcggtgtggcagttccttgccgcaccgctgttcggcgccagg
gtggagatcgtgccgaacgccatcgcccatgacccgcagggcctgctggcgcatgtgcag
gccaccggcatcagcgtgctggagagcgtgccgtcgctgatccagggcatgctggccaac
gaccaccaggccctcgatggcctgcgctggatgctgccgaccggcgaagccatgcctccg
gagctggcggcgcagtggctgcagcgctacccgcagatcggcctggtcaacgcctacggc
ccggcggagtgctccgatgacgtggcgttcttccgcgtcgatgccgcctcgacccgtggc
agctacctgccgatcggcacgccgaccgacaacaatcgtctgtacctgttcggcgaggac
caggcgctggtgccactgggtgcgacaggtgagctgtgcgtggctggcaccggcgtgggc
cgtggctatgtcggcgacccggtgcgcacggcgctggcgttcattccccatcctcatggt
gcaccgggcgaacgcctgtaccgcaccggcgacctggcgcggcagcgcccggacggggtg
ctggagtatgtcgggcgcatcgaccatcaggtgaagattcgcggctaccgcatcgaactg
ggcgaaatcgaagcccgcctgcacgaacagccggagatccgcgacgctgccgttggcgtg
caggagggcgtcaatggcaagcacctggtgggttacctggtggcgcatcagggcgttgca
gccgacgctgcgttgctggaacagctcaagctgcgcctgcgtgccgagttgccggagtac
atggtgccactgcactggggctggttcgacagcctgccgcacaacgccaacggcaagctc
gaccgcaaggccttgccggccatcgacatcggtggccagcacagccaggcctaccaggcg
ccgcgcaatgagctggaagaggtactggccggtatctgggcggatgtgctcaaggccgac
cgggtcggggtgcacgacaacttcttcgagctgggcgggcattcgctgctggccacgcag
atcgcctcgcgggtgcagaagcagctgcaactgaacgtgccgctgcgggcgatgttcgag
tgcagcacggtggaggagctggcggtgtatgtgcaggggctgcagggcagtgtgctggat
gacgacaaggtcgaccggctcagtgacctgatggccgagctggaggggttgtga

DBGET integrated database retrieval system