KEGG   Paenibacillus mucilaginosus 3016: PM3016_7319Help
Entry
PM3016_7319       CDS       T01757                                 

Definition
(GenBank) Npr
  KO
K01400  
bacillolysin [EC:3.4.24.28]
Organism
pmq  Paenibacillus mucilaginosus 3016
Brite
Enzymes [BR:pmq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     PM3016_7319
Peptidases [BR:pmq01002]
 Metallo Peptidases
  Family M4: thermolysin family
   PM3016_7319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(8557915..8559492)
Genome map
AA seq 525 aa AA seqDB search
MKRKLTSAVLIASLSTTVISAASAASPNAEVQYSKEYNTPEFISGRWQAPQGLGKAEKVW
NYLDSQKSLFAVNGDPKENFEILEEIADPEKGTYHVRLAQKYKGLKVFGAQQTVHLEDNG
GNASYLGQFVPDLDKKAKLKQKPQLSAQQAVEKAKQDAGEAVGPLTKFEIPPQAELQIYV
QGEDASLAYILELNFLEPKPGRWQYVIDAVSGKILAKWNKLDEVSAAGTGVNGDTKAFQS
TASSTGYTLVDGARKINTYTAGNRTSLPGSIVRDTDNYWTDGAAVDAHAHAAATYDYYKN
VHGRSSYDNAGAAIDSTVHYSYRYNNAFWNGYQMVYGDGDGVTFKALSGSLDVVAHELTH
AVTEYSAGLIYQNESGALNESISDIFGAMLDSGDWLLGEDVYTPGTSGDALRSLSNPAAY
GDPDHYSKRYTGTADNGGVHTNSGINNKAAYLLAQGGTHYGVSVQGIGREKTGKIYYRAL
TVYLTPSSNFRNMRQAAIQAATDLYGSTSAEAASVKAAYTAVGIN
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagaaagcttacttctgctgtactaattgcttcattatcgaccactgtaatttcc
gcagcctcggctgcctccccgaatgcagaggtccaatattcgaaagagtacaacactccc
gagttcatctccggccgctggcaggcacctcaaggcctcggcaaagctgagaaagtgtgg
aattatctggactctcaaaaatcgctgtttgccgtgaacggggatccgaaagagaatttt
gaaatcctcgaagaaattgccgatccggagaaaggtacatatcatgtaagattggcacaa
aaatataaagggttgaaagtcttcggtgcgcagcagacggttcacctggaggataatgga
ggcaatgcttcgtacctggggcagttcgtcccggatctcgacaagaaggcgaagctgaag
cagaagccgcagctctcggcccagcaggctgtagagaaagccaagcaggatgcgggcgaa
gcggtcggtccgctgaccaagttcgaaattccgccgcaggccgagctgcaaatctatgtg
cagggggaggacgcttcgctggcgtatatcctggagctgaacttcctggagccgaagccg
ggccgctggcagtatgtgatcgatgcggtcagcggcaagattctagcgaagtggaacaag
cttgacgaagtatcggctgcgggtacgggtgtcaacggggacacgaaggcgttccaatcc
acagcgtcatcgaccgggtatacgctggtggacggtgcgcgcaagatcaacacgtatacg
gcgggcaaccgtacgagccttccgggttcgatcgtgcgcgacacggacaactactggacg
gacggtgcagccgttgatgcccatgctcatgccgcagccacttacgattattacaagaat
gtacacggccgcagctcttacgacaatgcaggagccgccatcgattcgacggttcattac
tcctacaggtataataatgctttttggaacggctaccagatggtatacggtgacggcgac
ggggttactttcaaggcgctctccggcagcctggatgtagtggctcatgagctcacccac
gctgtgaccgaatactcggcaggtctgatctatcagaatgagtcgggggcactgaatgag
tcgatctccgatatcttcggggccatgctcgacagcggagactggctgctcggcgaggat
gtctatacaccgggtacttccggtgacgcgctacggtcgctctccaacccggccgcatac
ggagatcccgatcattacagcaagcgttacaccggtacagcggacaacggcggagtgcac
accaacagcggcatcaacaacaaagccgcttacctgctggcccagggcggaacgcattac
ggcgtaagcgtgcagggcatcggacgggagaagaccggcaagatctactatcgtgccctt
accgtatacctgacgccttcttccaacttccggaatatgagacaagcggccattcaagcc
gcaaccgatctgtatggttccacctctgcagaggcggcatcggtcaaagcggcatataca
gccgtgggaatcaattaa

DBGET integrated database retrieval system