KEGG   Paenibacillus mucilaginosus KNP414: KNP414_00640Help
Entry
KNP414_00640      CDS       T01550                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    KNP414_00640
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    KNP414_00640
Enzymes [BR:pms01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     KNP414_00640
Peptidoglycan biosynthesis and degradation proteins [BR:pms01011]
 Precursor biosynthesis
  Racemase
   KNP414_00640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
664668..665852
Genome map
AA seq 394 aa AA seqDB search
MDSFYRPTRVEISLDALRHNIGEFRRVLPEHVRMMAVVKADAYGHGAVEVCREVLQCGVE
YIAVAFLDEGLELRKAGITAPILVLGYTPPEGLETAWNHDITLNLYTDELLDAWERLGPR
ERPLRIHIKVDTGMNRIGVTGEEQAVTLIERALRIPGLQVEGLFTHYACADEEDKSYTLQ
QYARFQQVVEHFRSRGIEFPYVHAGNSAAAIDTPELTYNMVRLGISMYGLYPSDEVMKER
VDLQPVLSIKTGVVMLKKVPAGEGISYGAVYRPQEEETIATLPIGYADGFSRMLTGKAYA
LIRGRRVPIVGRICMDQCMMNVTPLADISSEEEVVILGRQGGETISAEEHAQWLGTVNYE
VVCMISHRVPRMYIRGGQVVSTINPLLRHLWERK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggattcgttttaccgtcctacgcgggtggagatctcgctggatgctttgcgccataac
atcggagagttccgcagggtgctgccggagcatgtgcggatgatggcggtggtcaaagcc
gacgcgtacggacacggtgcggtggaggtgtgccgggaggtgctgcagtgcggtgtggaa
tacatcgcggtagcgttcctggacgaaggcctggagcttcggaaggcgggcattaccgct
ccgattctggtgctgggctacacgccgccggaagggctggagacagcctggaaccatgat
atcacgctcaacctgtacacggatgaacttctggatgcctgggaacgactcggaccgcgg
gagcggccgctgcgcattcacatcaaggtcgacacaggaatgaaccggatcggcgtaacc
ggtgaagagcaggccgtcacgctcatcgagcgggcgctgcgcattcccggactgcaggtg
gaagggctgttcacccactatgcgtgcgcggacgaagaggacaaaagctatacgctgcag
cagtacgcgcgttttcagcaggtggtggaacacttccggagccggggaatcgagttcccc
tatgtgcacgccggcaacagtgccgcagcgattgacacgccggagctcacctacaacatg
gtgcggctcggcatctccatgtacggcctctatccgtcggatgaggtcatgaaggagcgg
gtcgacctgcagccggtcctcagtatcaagaccggtgtcgtcatgctgaagaaggtgcct
gcaggcgagggtatcagctatggcgcagtctaccggccccaggaagaggaaacgatcgcg
acgctgcccatcgggtatgcggacggcttctcccggatgctgacgggcaaggcgtatgct
ttgatccgcggcaggcgcgtgccgatcgttgggagaatttgcatggaccagtgtatgatg
aacgttacgccccttgccgatatttctagtgaggaagaagtcgtcatattaggaaggcag
gggggcgagaccatctcggcggaagagcatgcgcagtggctgggcacagtcaattacgaa
gtcgtctgtatgatctcccaccgggtgccccggatgtacatccgcggggggcaagtggtc
tcgaccatcaatccgctgctgcggcatttatgggagcgcaaataa

DBGET integrated database retrieval system